Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.12
PubTator Score 5.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.106 0.007
lung cancer -3.000 0.043
ovarian cancer -1.700 0.000

Synonym

Accession Q9P0U1 O95939
Symbols TOM7

Gene

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18331822 The human counterparts of Tom5 and Tom6, together with the other components including Tom7, were identified in the preprotein translocase complex.
12198123 Levels of Tom22 in mitochondria accelerate the rate of Tom7 assembly into the mature TOM complex.

AA Sequence

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG                     1 - 55
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18331822 2008 Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.
15644312 2005 Dissection of the mitochondrial import and assembly pathway for human Tom40.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
More...