Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.15
PubTator Score 5.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.3e-06
Multiple myeloma 1332 7.4e-03
lung cancer 4740 4.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -3.000 4.3e-02
Multiple myeloma 1.106 7.4e-03
ovarian cancer -1.700 1.3e-06

Gene RIF (4)

AA Sequence

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG                     1 - 55
//

Text Mined References (14)

PMID Year Title