Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.92
PubTator Score 1.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.0e-05
ovarian cancer 8520 2.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.446 1.0e-05
ovarian cancer 1.100 2.6e-02

 GO Process (1)

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MKLLSLVAVVGCLLVPPAEANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVEPMPVPGHDVE      1 - 70
AYCLLCECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENEDARSMAA     71 - 140
AAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS                               141 - 183
//

Text Mined References (22)

PMID Year Title