Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.84
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.800 1.2e-03
ovarian cancer -1.100 4.6e-03
primary pancreatic ductal adenocarcinoma 1.254 2.0e-03

Synonym

Accession Q9P0S9 Q5T4I6
Symbols NET26
C6orf53
HSPC194
MSTP073
bA421M1.6

Gene

PDB

2LOS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MQDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSG      1 - 70
TLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH                                 71 - 112
//

Text Mined References (12)

PMID Year Title