Property Summary

NCBI Gene PubMed Count 8
Grant Count 9
Funding $499,069.9
PubMed Score 6.84
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.254 0.002
acute myeloid leukemia -1.800 0.001
ovarian cancer 1.300 0.021

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19656490 Required for functional heme biosynthesis in erythroid cells.

AA Sequence

MQDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSG      1 - 70
TLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH                                 71 - 112
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19656490 2009 Discovery of genes essential for heme biosynthesis through large-scale gene expression analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12958361 2003 Nuclear membrane proteins with potential disease links found by subtractive proteomics.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...