Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.39
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.200 0.001
osteosarcoma -1.043 0.001
adrenocortical carcinoma -1.206 0.000
non-small cell lung cancer -1.338 0.000
lung cancer -1.500 0.040
gastric carcinoma -1.500 0.022

Synonym

Accession Q9P0S2 A6NDT5 A8K3X8
Symbols HSPC203
C14orf112

Gene

Gene RIF (2)

PMID Text
22082156 Knockdown of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI      1 - 70
KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT                                       71 - 106
//

Text Mined References (11)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15596615 2004 Studies of COX16, COX19, and PET191 in human cytochrome-c oxidase deficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446688 2003 COX16 encodes a novel protein required for the assembly of cytochrome oxidase in Saccharomyces cerevisiae.
More...