Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.66
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.206 2.9e-04
gastric carcinoma -1.500 2.2e-02
lung cancer -1.500 4.0e-02
non-small cell lung cancer -1.338 6.5e-18
osteosarcoma -1.043 1.3e-03
psoriasis -1.200 5.5e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI      1 - 70
KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT                                       71 - 106
//

Text Mined References (11)

PMID Year Title