Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.61
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26280900 demonstrate that overexpression of ATG2B and GSKIP enhances hematopoietic progenitor differentiation, including of megakaryocytes, by increasing progenitor sensitivity to thrombopoietin
21328310 analysis of the GSK3beta-GSKIPtide complex structure and the X-ray crystal structures of GSK3beta-FRATide and GSK3beta-AxinGID complexes suggests that the hydroxyl group of Y288 is crucial to maintaining a hydrogen bond network in GSK3beta-FRATide
16981698 GSKIP is a naturally occurring protein that is homologous with the GSK3beta interaction domain of Axin and is able to negatively regulate GSK3beta of the Wnt signaling pathway.

AA Sequence

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET      1 - 70
KERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS      71 - 139
//

Text Mined References (14)

PMID Year Title
26280900 2015 Germline duplication of ATG2B and GSKIP predisposes to familial myeloid malignancies.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
21328310 2011 Prediction of the binding mode between GSK3? and a peptide derived from GSKIP using molecular dynamics simulation.
20043192 2010 Involvement of the residues of GSKIP, AxinGID, and FRATtide in their binding with GSK3beta to unravel a novel C-terminal scaffold-binding region.
20007971 2010 Glycogen synthase kinase 3beta interaction protein functions as an A-kinase anchoring protein.
19830702 2009 GSKIP, an inhibitor of GSK3beta, mediates the N-cadherin/beta-catenin pool in the differentiation of SH-SY5Y cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16981698 2006 GSKIP is homologous to the Axin GSK3beta interaction domain and functions as a negative regulator of GSK3beta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...