Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.300 4.7e-04
astrocytic glioma -2.100 4.2e-03
atypical teratoid / rhabdoid tumor -1.200 2.5e-04
Breast cancer 3.500 2.7e-02
ependymoma -2.200 1.2e-02
glioblastoma -1.400 1.0e-03
group 4 medulloblastoma -1.200 2.0e-03
intraductal papillary-mucinous carcinoma... 1.400 5.2e-03
intraductal papillary-mucinous neoplasm ... 1.900 5.7e-03
medulloblastoma, large-cell -1.200 3.0e-03
nasopharyngeal carcinoma -1.100 7.2e-08
oligodendroglioma -2.100 1.3e-02
ovarian cancer -1.400 3.4e-04
pancreatic cancer 1.500 9.7e-03
primary pancreatic ductal adenocarcinoma 1.748 2.9e-03

Synonym

Accession Q9P0R6 B3KSZ0 Q9BST1 Q9NWK0 GSKIP
Symbols HSPC210
C14orf129

Gene

PDB

1SGO  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET      1 - 70
KERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS      71 - 139
//

Text Mined References (16)

PMID Year Title