Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.25
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.300 2.8e-05
pancreatic ductal adenocarcinoma liver m... -1.425 6.3e-03

Gene RIF (5)

AA Sequence

MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGS      1 - 70
QAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQ     71 - 140
QHRLENLHGAMYT                                                             141 - 153
//

Text Mined References (17)

PMID Year Title