Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.25
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.425 0.006
ovarian cancer 1.300 0.000

Gene RIF (5)

PMID Text
26711259 RNF181 limits the proliferation of human diffuse large B cell lymphoma cells that depend upon aberrant CARD11 signaling to NF-kappaB for growth and survival in culture.
26398855 The identification and validation of proteins interacting with HSP238 may lead to the discovery of novel mechanisms through which HSPC238 suppresses tumorigenesis in human hepatocellular carcinoma
21391225 RN181 suppresses the tumorigenesis of hepatocellular carcinoma through the inhibition of ERK/MAPK signaling in the liver.
19426595 Data show LOC51255 (RNF181) protein located in the cytoplasm of HePG2 cell line.
18331836 The presence of RN181 in human platelets was established; RN181 has ubiquitin E3 ligase activity.

AA Sequence

MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGS      1 - 70
QAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQ     71 - 140
QHRLENLHGAMYT                                                             141 - 153
//

Text Mined References (17)

PMID Year Title
26711259 2015 Negative Regulation of CARD11 Signaling and Lymphoma Cell Survival by the E3 Ubiquitin Ligase RNF181.
26398855 2015 Screening and verification of proteins that interact with HSPC238.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
21743467 2011 Seven prostate cancer susceptibility loci identified by a multi-stage genome-wide association study.
21391225 2011 RN181 suppresses hepatocellular carcinoma growth by inhibition of the ERK/MAPK pathway.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19426595 2009 [Construction of recombinant eukaryotic expression vector pDsRed1-C3/LOC51255 and subcellular localization of LOC51255 protein in HePG2 cell line].
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18331836 2008 RN181, a novel ubiquitin E3 ligase that interacts with the KVGFFKR motif of platelet integrin alpha(IIb)beta3.
More...