Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
R01 Count 1
Funding $53,571.5
PubMed Score 104.97
PubTator Score 86.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
psoriasis -1.700 0.001
osteosarcoma -2.810 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -2.100 0.000
lung cancer -1.700 0.001
mucosa-associated lymphoid tissue lympho... 1.078 0.005

Synonym

Accession Q9P0N8 A6NP10 Q5H785 Q8N5A3 Q96B78
Symbols RNF172
HSPC240
MARCH-II

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (4)

PMID Text
23818989 Data indicate that E3 ubiquitin ligase MARCH2 co-immunoprecipitated and co-localized with CAL and syntaxin 6 (STX6), and show the ubiquitination of CFTR by MARCH2.
23166351 The MARCH2 E3 ligase activity regulates cell surface beta(2)AR expression and, consequently, its signaling.
17980554 MARCH2 is co-localized with DLG1 at sites of cell-cell contact.
15689499 Depletion of MARCH-II by small interfering RNA perturbed the trans-Golgi network (TGN) localization of syntaxin 6 and TGN38/46

AA Sequence

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEG      1 - 70
ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC     71 - 140
DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT    141 - 210
NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV                                      211 - 246
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23818989 2013 Ubiquitination and degradation of CFTR by the E3 ubiquitin ligase MARCH2 through its association with adaptor proteins CAL and STX6.
23166351 2012 MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound ?(2)-adrenergic receptors.
17980554 2008 DLG1 is an anchor for the E3 ligase MARCH2 at sites of cell-cell contact.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16428329 2006 MARCH-III Is a novel component of endosomes with properties similar to those of MARCH-II.
15689499 2005 MARCH-II is a syntaxin-6-binding protein involved in endosomal trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...