Property Summary

NCBI Gene PubMed Count 16
PubMed Score 106.75
PubTator Score 86.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.9e-05
group 4 medulloblastoma -1.400 3.3e-03
lung cancer -1.700 1.4e-03
malignant mesothelioma -3.000 8.5e-07
medulloblastoma, large-cell -2.100 4.3e-06
mucosa-associated lymphoid tissue lympho... 1.078 4.8e-03
osteosarcoma -2.810 1.3e-04
psoriasis -1.700 1.1e-03

Gene RIF (5)

AA Sequence

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEG      1 - 70
ANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCC     71 - 140
DMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKT    141 - 210
NQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV                                      211 - 246
//

Text Mined References (17)

PMID Year Title