Property Summary

NCBI Gene PubMed Count 27
PubMed Score 124.58
PubTator Score 48.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 4.900 1.9e-55
group 3 medulloblastoma -1.100 4.8e-03
osteosarcoma 2.881 4.2e-09

Gene RIF (23)

AA Sequence

MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSL      1 - 70
EAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTG     71 - 140
RETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV                 141 - 197
//

Text Mined References (28)

PMID Year Title