Property Summary

NCBI Gene PubMed Count 24
Grant Count 21
R01 Count 14
Funding $2,644,188
PubMed Score 116.58
PubTator Score 48.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.881 0.000
group 3 medulloblastoma -1.100 0.005
psoriasis 4.900 0.000

Gene RIF (20)

PMID Text
26472015 CpG methylation is reduced in gingival biopsies of patients with periodontitis
25012243 Those carrying rs3748067 CC genotype and C allele had a significantly increased risk for the development of gastric cancer
23944933 IL-17C is an essential epithelial cell-derived cytokine.
23892590 Our study provides evidence that Staphylococcus aureus activates NOD2 in keratinocytes, resulting in an increased expression of IL-17C, a mechanism that may be dysregulated in atopic dermatitis.
23474800 Interleukin-17C is present in the tissue around aseptic loosened implants.
23359500 Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation.
23221046 IL-17C is involved in the innate immune response of respiratory epithelial cells and is suppressed by cigarette smoke.
22994872 Data suggest that activation of TLR5 upregulates IL17C expression in cells from intestinal mucosa and colonic adenocarcinoma; IL17C expression is upregulated in intestinal mucosa cells from patients with ulcerative colitis compared with normal cells.
22506826 In our pilot study, we discovered significant changes in methylation patterns of genes IL-7, IL-13, IL-17C and TYK2 between henodialysis patients and healthy subjects
21993848 IL-17C is an essential autocrine cytokine that regulates innate epithelial immune responses.
More...

AA Sequence

MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSL      1 - 70
EAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTG     71 - 140
RETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV                 141 - 197
//

Text Mined References (25)

PMID Year Title
26472015 2016 Epigenetic characteristics in inflammatory candidate genes in aggressive periodontitis.
25012243 2014 IL-17 gene polymorphism is associated with susceptibility to gastric cancer.
23944933 2014 Toll-like receptor-mediated airway IL-17C enhances epithelial host defense in an autocrine/paracrine manner.
23892590 2014 The pattern recognition receptor NOD2 mediates Staphylococcus aureus-induced IL-17C expression in keratinocytes.
23474800 2013 Presence of interleukin-17C in the tissue around aseptic loosened implants.
23359500 2013 Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation.
23221046 2013 IL-17C is a mediator of respiratory epithelial innate immune response.
22994872 2012 Toll-like receptor 5 engagement induces interleukin-17C expression in intestinal epithelial cells.
22506826 2012 Alterations in methylation status of immune response genes promoters in cell-free DNA during a hemodialysis procedure.
21993849 2011 IL-17RE is the functional receptor for IL-17C and mediates mucosal immunity to infection with intestinal pathogens.
More...