Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.30
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKS      1 - 70
DQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDE     71 - 140
VNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETANRTFQEKGILV    141 - 210
GESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESS    211 - 280
IVIGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK      281 - 348
//

Text Mined References (19)

PMID Year Title