Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 14
Funding $1,269,170.84
PubMed Score 25.39
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
24302730 PKC tethered to AKAP7alpha was less susceptible to inhibition from the ATP-competitive inhibitor Go6976 and the substrate-competitive inhibitor PKC 20-28, but not the activation-competitive inhibitor calphostin C.
22670899 Data from studies using recombinant proteins suggest that both AKAP7-gamma and AKAP7-alpha exhibit high-affinity interactions with isoenzymes of PKC (protein kinase C); AKAP7 could dictate PKC localization/function.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18082768 AKAP18 contains a phosphodiesterase domain that binds AMP.
17244820 AKAP15 regulates ENaC via a novel PKA-independent pathway
12804576 AKAP7gamma is the first nuclear AKAP to bind RI and may be responsible for positioning PKA via RI and/or RII to regulate PKA-mediated gene transcription in both somatic cells and oocytes

AA Sequence

MERPEAGGINSNECENVSRKKKMSEEFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKS      1 - 70
DQVKKRKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDE     71 - 140
VNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETANRTFQEKGILV    141 - 210
GESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESS    211 - 280
IVIGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK      281 - 348
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24302730 2014 Scaffold state switching amplifies, accelerates, and insulates protein kinase C signaling.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
22670899 2012 Spatiotemporal regulation of PKC via interactions with AKAP7 isoforms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18082768 2008 AKAP18 contains a phosphoesterase domain that binds AMP.
17244820 2007 The A-kinase anchoring protein 15 regulates feedback inhibition of the epithelial Na+ channel.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...