Property Summary

Ligand Count 2
NCBI Gene PubMed Count 34
PubMed Score 56.11
PubTator Score 844.23

Knowledge Summary

Patent (3,082)

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
lung cancer 1.400 1.2e-04
breast carcinoma -1.400 1.8e-05
ependymoma -1.200 8.4e-03
fibroadenoma -1.400 1.2e-02
interstitial cystitis -1.500 7.2e-04
lung carcinoma 2.400 2.8e-31
malignant mesothelioma 1.200 2.1e-06
nasopharyngeal carcinoma 1.500 6.8e-03
non-small cell lung cancer 1.778 3.3e-13
sonic hedgehog group medulloblastoma -1.400 3.2e-02

Gene RIF (10)

AA Sequence

MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGN      1 - 70
FAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYAS     71 - 140
GGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVG    141 - 210
NKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYM    211 - 280
STDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEIN    281 - 350
DALINQKYDEVMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR    351 - 420
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPS    421 - 490
NNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGH    491 - 560
PIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGP    561 - 630
PASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL    631 - 700
RFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGV    701 - 770
RFKRISGTSIAFKNIASKIANELKL                                                 771 - 795
//

Text Mined References (47)

PMID Year Title