Property Summary

NCBI Gene PubMed Count 33
Grant Count 2
Funding $128,665.67
PubMed Score 54.74
PubTator Score 844.23

Knowledge Summary

Patent (3,082)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma -1.700 0.000
non-small cell lung cancer 1.778 0.000
lung cancer 1.400 0.000
breast carcinoma -1.400 0.000
fibroadenoma -1.400 0.012
interstitial cystitis -1.600 0.001
sonic hedgehog group medulloblastoma -1.400 0.032
nasopharyngeal carcinoma 1.500 0.007
lung carcinoma 2.400 0.000

Synonym

Accession Q9P0L2 D3DTB0 D3DTB1 Q2HIY1 Q5VTF9 Q5VTG0 Q96SW9 Q9P251
Symbols MARK
Par1c
Par-1c

Gene

 Grant Application (2)

PDB

2HAK   3OSE  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (9)

PMID Text
24362629 LKB1 acts through its substrates of the microtubule affinity-regulating kinase family to regulate the localization of the polarity determinant Scribble and the activity of the core Hippo kinases
24243102 the positioning of MARK/Par-1 at the crosstalk of regulating cytoskeletal dynamics allows its participation in neuronal polarity decisions. [review]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20158304 In the Australian GWAS, the SNP rs7530302 near MARK1 on chromosome 1 (p=1.90 x 10(-9) achieved genomewide significance for comorbid AD/ND.
19090997 Data show that protein kinases of the MARK family phosphorylate tau protein in its repeat domain and thereby regulate its affinity for microtubules and affect the aggregation of tau into Alzheimer paired helical filaments.
18976975 Knockdown of MAP/microtubule affinity-regulating kinase 1 (MARK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18492799 MARK1 was overexpressed in a prefrontal region in the brains of patients with Autism spectrum disorders.
18492799 Observational study of gene-disease association. (HuGE Navigator)
16803889 analysis of variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2

AA Sequence

MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNYRLQKTIGKGN      1 - 70
FAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYAS     71 - 140
GGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVG    141 - 210
NKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYM    211 - 280
STDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEIN    281 - 350
DALINQKYDEVMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR    351 - 420
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPS    421 - 490
NNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGH    491 - 560
PIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGP    561 - 630
PASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL    631 - 700
RFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGV    701 - 770
RFKRISGTSIAFKNIASKIANELKL                                                 771 - 795
//

Text Mined References (46)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24362629 2014 A genetic screen identifies an LKB1-MARK signalling axis controlling the Hippo-YAP pathway.
24243102 2014 Mark/Par-1 marking the polarity of migrating neurons.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22205951 2011 Genome-wide association study in bipolar patients stratified by co-morbidity.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21145462 2010 Kinase associated-1 domains drive MARK/PAR1 kinases to membrane targets by binding acidic phospholipids.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...