Property Summary

NCBI Gene PubMed Count 9
PubMed Score 100.64
PubTator Score 37.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.5e-03
atypical teratoid / rhabdoid tumor 1.300 2.8e-04
gastric cancer 1.300 1.4e-03
glioblastoma 1.300 4.2e-05
group 3 medulloblastoma 2.300 4.1e-04
hepatocellular carcinoma 1.400 8.7e-06
lung carcinoma 1.100 8.1e-22
medulloblastoma, large-cell 1.200 8.0e-03
non primary Sjogren syndrome sicca -1.100 4.2e-02
ovarian cancer -2.200 8.9e-07
primitive neuroectodermal tumor 1.800 3.8e-04
psoriasis -1.200 8.5e-03

AA Sequence

MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQE      1 - 70
ALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSE     71 - 140
EVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQV    141 - 210
GNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSE    211 - 280
LTPKQEFFKGSESSNRTSGGLFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKST    281 - 350
KDRYDKYKEVGEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF    351 - 420
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSRLTDHQRTHT    421 - 490
GEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLIDHQRIHTGEKPYECSECGKAF    491 - 560
SRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERIHTGEKPFECSECGKAFGLSKCLIRHQRLHT    561 - 630
GEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAF    631 - 700
SDSSQLIVHQRVHTGEKPYECSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS                    701 - 754
//

Text Mined References (10)

PMID Year Title