Property Summary

NCBI Gene PubMed Count 9
PubMed Score 96.64
PubTator Score 37.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.10539847169797E-22
ovarian cancer 8492 8.87103241912572E-7
hepatocellular carcinoma 550 8.6895522248828E-6
atypical teratoid/rhabdoid tumor 1095 2.96093306994962E-5
glioblastoma 5572 4.15640816581307E-5
primitive neuroectodermal tumor 3031 3.80612295915792E-4
group 3 medulloblastoma 2254 4.12021550578955E-4
gastric cancer 436 0.00135933191841244
medulloblastoma, large-cell 6234 0.00803687692090025
psoriasis 6685 0.00852173754641479
non primary Sjogren syndrome sicca 840 0.0423259632773454
Disease Target Count Z-score Confidence
Denys-Drash syndrome 11 3.706 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.300 0.001
hepatocellular carcinoma 1.400 0.000
psoriasis -1.200 0.009
glioblastoma 1.300 0.000
group 3 medulloblastoma 2.300 0.000
atypical teratoid/rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.200 0.008
primitive neuroectodermal tumor 1.800 0.000
non primary Sjogren syndrome sicca -1.100 0.042
lung carcinoma 1.100 0.000
ovarian cancer -2.200 0.000

Synonym

Accession Q9P0L1 A0PJV3 A8K5H0 Q6WL09 Q96FQ2
Symbols ZFP
ZNF64
ZNF167
ZNF448
ZSCAN39

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

AA Sequence

MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQE      1 - 70
ALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSE     71 - 140
EVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQV    141 - 210
GNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSE    211 - 280
LTPKQEFFKGSESSNRTSGGLFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKST    281 - 350
KDRYDKYKEVGEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF    351 - 420
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSSRLTDHQRTHT    421 - 490
GEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLIDHQRIHTGEKPYECSECGKAF    491 - 560
SRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERIHTGEKPFECSECGKAFGLSKCLIRHQRLHT    561 - 630
GEKPYKCNECGKSFNQNSHLIIHQRIHTGEKPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAF    631 - 700
SDSSQLIVHQRVHTGEKPYECSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS                    701 - 754
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7814019 1995 Positional cloning of cDNAs from the human chromosome 3p21-22 region identifies a clustered organization of zinc-finger genes.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.