Property Summary

NCBI Gene PubMed Count 48
PubMed Score 419.81
PubTator Score 69.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.000 3.2e-05
atypical teratoid / rhabdoid tumor -2.200 9.9e-07
Breast cancer -1.300 2.4e-15
breast carcinoma 1.200 4.8e-03
ependymoma -1.200 2.7e-06
glioblastoma -1.500 3.0e-06
invasive ductal carcinoma -1.800 1.6e-03
medulloblastoma -1.100 1.0e-04
medulloblastoma, large-cell -1.200 4.9e-05
Multiple myeloma 1.109 2.3e-04
non-small cell lung cancer -2.209 1.1e-29
osteosarcoma 1.610 3.1e-05
ovarian cancer -1.600 2.9e-06
psoriasis -1.100 4.9e-27
subependymal giant cell astrocytoma -2.371 3.5e-02
tuberculosis and treatment for 6 months 1.200 4.3e-05
Waldenstrons macroglobulinemia 1.093 2.7e-03

Gene RIF (19)

AA Sequence

MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP      1 - 70
GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN     71 - 140
DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD    141 - 210
KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL                                   211 - 249
//

Text Mined References (56)

PMID Year Title