Property Summary

NCBI Gene PubMed Count 43
Grant Count 104
R01 Count 60
Funding $7,477,942.99
PubMed Score 411.81
PubTator Score 69.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 0.003
Multiple myeloma 1.109 0.000
osteosarcoma 1.610 0.000
ependymoma -1.200 0.000
glioblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -2.400 0.000
tuberculosis and treatment for 6 months 1.200 0.000
non-small cell lung cancer -2.209 0.000
breast carcinoma 1.200 0.005
adult high grade glioma -2.000 0.000
psoriasis -1.100 0.000
subependymal giant cell astrocytoma -2.371 0.035
Breast cancer -1.500 0.000
invasive ductal carcinoma -1.800 0.002
ovarian cancer -2.700 0.000

Synonym

Accession Q9P0L0 A6NDZ0 D3DUI3 O75453 Q5U0E7 Q9UBZ2 VAMP-A
Symbols VAP-A
VAP33
VAP-33
hVAP-33

Gene

PDB

2RR3  

Gene RIF (17)

PMID Text
26490117 Our work revealed that VAP-A/B knockdown impaired the processing and secretion of PAUF, which is one of the cargo proteins of carriers of the trans-Golgi network to the cell surface.
25681634 The effects of sterol manipulation of HuH7 cells on complexes of established sterol-binding Oxysterol-binding protein related proteins with their endoplasmic reticulum receptor, VAMP-associated protein A (VAPA), were examined.
25447204 phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling.
24569996 phosphorylation of CERT at the FFAT motif-adjacent serine affects its affinity for VAP, which may regulate the inter-organelle trafficking of ceramide in response to the perturbation of cellular sphingomyelin and/or other sphingolipids
24223774 GPS2 is required for the association of viral NS5A with VAP-A and hepatitis C virus replication.
24105263 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum.
22190034 HIV-1 gp41 is identified to have a physical interaction with VAMP (vesicle-associated membrane protein)-associated protein A (VAPA) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21957124 Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein VAP-33.
21152411 Data show that the methylated VAPA-APCDD1 DNA in maternal plasma is predominantly derived from the fetus, and this novel fetal epigenetic marker in maternal plasma is useful for the noninvasive detection of fetal trisomy 18.
21144830 three conserved prolines in VAPA and Scs2p confers less vulnerability to mutations equivalent to the amyotrophic lateral sclerosis causing mutation as compared with VAPB, which has only two conserved prolines.
More...

AA Sequence

MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP      1 - 70
GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN     71 - 140
DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD    141 - 210
KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL                                   211 - 249
//

Text Mined References (51)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490117 2015 CARTS biogenesis requires VAP-lipid transfer protein complexes functioning at the endoplasmic reticulum-Golgi interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25681634 2015 Sterol liganding of OSBP-related proteins (ORPs) regulates the subcellular distribution of ORP-VAPA complexes and their impacts on organelle structure.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25447204 2015 OSBP-related protein 3 (ORP3) coupling with VAMP-associated protein A regulates R-Ras activity.
24569996 2014 Phosphoregulation of the ceramide transport protein CERT at serine 315 in the interaction with VAMP-associated protein (VAP) for inter-organelle trafficking of ceramide in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223774 2013 GPS2 is required for the association of NS5A with VAP-A and hepatitis C virus replication.
More...