Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $8,825
PubMed Score 31.89
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytoma -3.100 0.015
ependymoma -2.500 0.000
glioblastoma -4.500 0.001
oligodendroglioma -1.900 0.000
group 3 medulloblastoma -3.000 0.001
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.100 0.019
adrenocortical carcinoma -1.389 0.037
colon cancer -2.100 0.000
adult high grade glioma -3.800 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -4.364 0.009
lung carcinoma 3.500 0.000
ovarian cancer 1.500 0.000
pituitary cancer 1.200 0.000
psoriasis -1.100 0.000

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHPGVWASLLLLL      1 - 70
LTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPV     71 - 140
DPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDV    141 - 210
MACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLF    211 - 280
AWGPAIQGSITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP          281 - 344
//

Text Mined References (6)

PMID Year Title
27239025 2016 Epileptic encephalopathy with continuous spike-and-wave during sleep maps to a homozygous truncating mutation in AMPA receptor component FRRS1L.
27236917 2016 Loss-of-Function Mutations in FRRS1L Lead to an Epileptic-Dyskinetic Encephalopathy.
15164053 2004 DNA sequence and analysis of human chromosome 9.
10603000 2000 Cloning, mapping, and expression of a novel brain-specific transcript in the familial dysautonomia candidate region on chromosome 9q31.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.