Property Summary

NCBI Gene PubMed Count 6
PubMed Score 31.89
PubTator Score 12.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 4.44875476295706E-47
oligodendroglioma 2849 4.52296136495854E-12
ovarian cancer 8492 2.60613769356163E-10
psoriasis 6685 4.26763554273872E-10
ependymoma 2514 9.91632592505222E-10
pituitary cancer 1972 7.47358961013361E-8
colon cancer 1475 6.77813878098368E-7
medulloblastoma, large-cell 6234 7.68034946942306E-7
atypical teratoid / rhabdoid tumor 4369 1.16997089923323E-6
adult high grade glioma 2148 1.425254907463E-6
pilocytic astrocytoma 3086 1.00153309715723E-5
malignant mesothelioma 3163 2.88514308042045E-5
group 3 medulloblastoma 2254 8.10912688801256E-4
glioblastoma 5572 9.85769704218973E-4
subependymal giant cell astrocytoma 2287 0.00886358615666754
astrocytoma 1493 0.0150869267261286
primitive neuroectodermal tumor 3031 0.0190103801225338
adrenocortical carcinoma 1427 0.0366412781602874
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytoma -3.100 0.015
ependymoma -2.500 0.000
glioblastoma -4.500 0.001
oligodendroglioma -1.900 0.000
group 3 medulloblastoma -3.000 0.001
atypical teratoid / rhabdoid tumor -4.000 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.100 0.019
adrenocortical carcinoma -1.389 0.037
colon cancer -2.100 0.000
adult high grade glioma -3.800 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -4.364 0.009
lung carcinoma 3.500 0.000
ovarian cancer 1.500 0.000
pituitary cancer 1.200 0.000
psoriasis -1.100 0.000

Synonym

Accession Q9P0K9 Q5T4G4
Symbols CG6
CG-6
C9orf4
EIEE37

Gene

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHPGVWASLLLLL      1 - 70
LTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPV     71 - 140
DPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDV    141 - 210
MACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLF    211 - 280
AWGPAIQGSITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP          281 - 344
//

Text Mined References (6)

PMID Year Title
27239025 2016 Epileptic encephalopathy with continuous spike-and-wave during sleep maps to a homozygous truncating mutation in AMPA receptor component FRRS1L.
27236917 2016 Loss-of-Function Mutations in FRRS1L Lead to an Epileptic-Dyskinetic Encephalopathy.
15164053 2004 DNA sequence and analysis of human chromosome 9.
10603000 2000 Cloning, mapping, and expression of a novel brain-specific transcript in the familial dysautonomia candidate region on chromosome 9q31.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.