Property Summary

NCBI Gene PubMed Count 6
PubMed Score 35.99
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.389 3.7e-02
adult high grade glioma -1.900 1.2e-03
astrocytic glioma -1.500 5.4e-03
Astrocytoma, Pilocytic -1.400 9.4e-06
atypical teratoid / rhabdoid tumor -2.200 8.1e-05
colon cancer -2.100 6.8e-07
ependymoma -2.000 1.9e-02
glioblastoma -1.800 1.6e-04
group 3 medulloblastoma -2.800 1.1e-03
lung carcinoma 3.500 4.4e-47
malignant mesothelioma -1.700 2.9e-05
medulloblastoma, large-cell -1.700 9.5e-06
oligodendroglioma -1.500 1.2e-12
ovarian cancer 1.500 2.6e-10
pituitary cancer 1.200 7.5e-08
primitive neuroectodermal tumor -2.100 1.9e-02
psoriasis -1.100 4.3e-10
subependymal giant cell astrocytoma -3.556 1.2e-02

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MRRPRQGGGGAGGSAAARARAGGLGGGSVPARARGAPAAARAAWLRDLCARMARPPRQHPGVWASLLLLL      1 - 70
LTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPV     71 - 140
DPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDV    141 - 210
MACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLF    211 - 280
AWGPAIQGSITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP          281 - 344
//

Text Mined References (6)

PMID Year Title