Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
R01 Count 2
Funding $535,276
PubMed Score 52.80
PubTator Score 53.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.576 0.000
lung cancer -1.900 0.000

Synonym

Accession Q9P0K8 A0AVK4 B2RMP3 Q96PS9 Q9NSN5
Symbols FHX

Gene

 Grant Application (2)

Gene RIF (11)

PMID Text
25873280 Data shows that FOXJ2 is downregulated in extrahepatic cholangiocarcinoma tissues and associates with disease progression. Its overexpression inhibits cell proliferation, migration and invasion in vitro indicating a role as tumor suppressor gene.
25661068 FoxJ2 suppressed cell migration and invasion in glioma
25451482 Our analysis showed significant downregulation of miRNAs, let-7b and miR-197, out of which miR-197 was predicted to target FOXJ2.
24792364 MicroRNA-34a targets FOXJ2 to modulate differentiation of endothelial progenitor cells in response to shear stress.
22441887 Study demonstrates that FOXJ2 can inhibit the metastasis of human breast cancer by regulating the EMT key markers E-cadherin and vimentin.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of forkhead box J2 (FOXJ2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
More...

AA Sequence

MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYS      1 - 70
YATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYW     71 - 140
TIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGS    141 - 210
VDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQHGFSSLLGD    211 - 280
IPPSNNYYMYQQQQPPPPQQQQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCTPPGGK    281 - 350
QAGAEGYGPPPVMAMHPPPLQHGGYHPHQHHPHSHPAQQPPPPQPQAQGQAPINNTGFAFPSDWCSNIDS    351 - 420
LKESFKMVNRLNWSSIEQSQFSELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQTGHVPPQGGTHRPP    421 - 490
APARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGA    491 - 560
NEEIPDDFDWDLIT                                                            561 - 574
//

Text Mined References (30)

PMID Year Title
25873280 2015 Abnormal expression of Forkhead Box J2 (FOXJ2) suppresses migration and invasion in extrahepatic cholangiocarcinoma and is associated with prognosis.
25661068 2015 The role of FoxJ2 in the migration of human glioma cells.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25451482 2015 STAT6 silencing up-regulates cholesterol synthesis via miR-197/FOXJ2 axis and induces ER stress-mediated apoptosis in lung cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24792364 2014 MicroRNA-34a targets Forkhead box j2 to modulate differentiation of endothelial progenitor cells in response to shear stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22441887 2012 Overexpression of forkhead box J2 can decrease the migration of breast cancer cells.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
More...