Property Summary

NCBI Gene PubMed Count 25
PubMed Score 54.74
PubTator Score 53.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 2.6e-06
lung cancer 4607 5.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.900 5.3e-05
osteosarcoma -1.576 2.6e-06

 GO Component (2)

Gene RIF (14)

AA Sequence

MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAAVHQDGKPRYS      1 - 70
YATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYW     71 - 140
TIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGS    141 - 210
VDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQHGFSSLLGD    211 - 280
IPPSNNYYMYQQQQPPPPQQQQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCTPPGGK    281 - 350
QAGAEGYGPPPVMAMHPPPLQHGGYHPHQHHPHSHPAQQPPPPQPQAQGQAPINNTGFAFPSDWCSNIDS    351 - 420
LKESFKMVNRLNWSSIEQSQFSELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQTGHVPPQGGTHRPP    421 - 490
APARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGA    491 - 560
NEEIPDDFDWDLIT                                                            561 - 574
//

Text Mined References (33)

PMID Year Title