Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.46
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.200 1.7e-03
ductal carcinoma in situ 1.200 2.4e-03
gastric carcinoma 1.700 2.7e-02
glioblastoma 1.100 2.9e-06
group 3 medulloblastoma 1.400 1.6e-03
invasive ductal carcinoma 1.425 1.3e-03
juvenile dermatomyositis 1.048 5.2e-09
lung carcinoma -2.600 4.3e-30
medulloblastoma, large-cell 1.700 1.9e-03
nasopharyngeal carcinoma 1.400 4.8e-03
ovarian cancer 2.200 9.4e-06
pancreatic cancer 1.200 5.5e-05
posterior fossa group A ependymoma 1.200 8.7e-09
primitive neuroectodermal tumor 1.700 8.7e-05
psoriasis -1.500 3.7e-07
spina bifida -1.801 4.7e-02

Gene RIF (2)

AA Sequence

MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLR      1 - 70
VMITHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAAQGCLQAVQILCE     71 - 140
HKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTALMLACEIGSSNAVEALIKKGAD    141 - 210
LNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPI    211 - 280
SPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLS    281 - 350
LLQAKVASLTLHNKELQDKLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPSVLIHSL    351 - 420
GKSTTDNDVRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSDLSQKLKETQS    421 - 490
KYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQNALEESERNKEKVRELEEKL    491 - 560
VEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEKYQEAQEEIMKLKDTLKSQMTQEASDEAEDM    561 - 630
KEAMNRMIDELNKQVSELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEDALS    631 - 700
EMKSQYSKVLNELTQLKQLVDAQKENSVSITEHLQVITTLRTAAKEMEEKISNLKEHLASKEVEVAKLEK    701 - 770
QLLEEKAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQT    771 - 840
LLKSKEQEVNELLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYSTSS    841 - 910
SKRQSQQLEALQQQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDEDVQKVLKQILTMCKNQSQKK    911 - 980
//

Text Mined References (25)

PMID Year Title