Property Summary

NCBI Gene PubMed Count 26
PubMed Score 35.23
PubTator Score 30.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -1.154 1.6e-02
acute myeloid leukemia -1.100 2.0e-02
adrenocortical carcinoma -1.283 1.1e-02
adult high grade glioma -2.200 2.2e-05
Astrocytoma, Pilocytic -1.400 1.4e-05
Atopic dermatitis -1.400 2.3e-04
atypical teratoid / rhabdoid tumor -4.700 5.8e-07
colon cancer -1.100 1.4e-02
cutaneous lupus erythematosus -1.400 4.6e-03
ependymoma -3.200 1.1e-13
glioblastoma -2.300 1.8e-09
group 3 medulloblastoma -1.900 2.3e-04
interstitial cystitis -2.200 3.2e-04
lung cancer 1.500 6.7e-03
lung carcinoma 1.300 2.6e-22
malignant mesothelioma 1.500 2.1e-05
medulloblastoma, large-cell -3.200 3.2e-06
nasopharyngeal carcinoma 1.600 9.6e-05
osteosarcoma 1.149 1.7e-04
Pick disease -1.600 5.4e-03
pituitary cancer 1.900 1.7e-05
primitive neuroectodermal tumor -1.900 5.6e-04
psoriasis 1.800 4.1e-05
subependymal giant cell astrocytoma -3.817 1.8e-02
urothelial carcinoma -1.600 3.7e-03

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDAL      1 - 70
DTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGH     71 - 140
IRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNIT    141 - 210
PSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQ    211 - 280
LKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICS    281 - 350
LLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIE    351 - 420
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLC    421 - 490
CKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQ    491 - 560
KVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQG    561 - 630
RTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKC    631 - 700
VCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLP    701 - 770
QGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLG    771 - 840
GNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI        841 - 906
//

Text Mined References (28)

PMID Year Title