Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.00
PubTator Score 30.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.63663064596215E-22
ependymoma 2514 1.1227608933098E-13
atypical teratoid / rhabdoid tumor 4369 5.79425806310338E-7
interstitial cystitis 2299 1.70889125572943E-6
medulloblastoma 1524 1.73248008502933E-6
medulloblastoma, large-cell 6234 3.16492658693108E-6
pediatric high grade glioma 2712 5.04866746056105E-6
glioblastoma 5572 6.42962871529978E-6
pilocytic astrocytoma 3086 9.10040266620257E-6
pituitary cancer 1972 1.70807092242954E-5
colon cancer 1475 2.00002869018882E-5
malignant mesothelioma 3163 2.11330807672265E-5
psoriasis 6685 3.83722651162993E-5
osteosarcoma 7933 5.63879025858391E-5
nasopharyngeal carcinoma 1056 9.57471625838781E-5
Atopic dermatitis 944 2.3084054966237E-4
primitive neuroectodermal tumor 3031 5.64318841323745E-4
urothelial carcinoma 318 0.00368839952256114
cutaneous lupus erythematosus 1056 0.00456081718640557
Pick disease 1893 0.0054452870080756
adrenocortical carcinoma 1427 0.0109225827426819
lung cancer 4473 0.0120231772612402
active ulcerative colitis 477 0.0157435848551387
subependymal giant cell astrocytoma 2287 0.0175751124643489
acute myeloid leukemia 785 0.02045916474908
Disease Target Count Z-score Confidence
Epilepsy 346 4.012 2.0
Encephalitis 54 3.129 1.6
Amnestic disorder 37 3.011 1.5

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.600 0.004
malignant mesothelioma 1.500 0.000
cutaneous lupus erythematosus -1.400 0.005
psoriasis -1.900 0.000
glioblastoma -3.100 0.000
osteosarcoma 1.701 0.000
ependymoma -3.200 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.900 0.001
Atopic dermatitis -1.400 0.000
adrenocortical carcinoma -1.283 0.011
lung cancer 1.800 0.012
colon cancer -2.300 0.000
active ulcerative colitis -1.154 0.016
interstitial cystitis -2.700 0.000
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -3.817 0.018
nasopharyngeal carcinoma 1.600 0.000
lung carcinoma 1.300 0.000
Pick disease -1.600 0.005
acute myeloid leukemia -1.100 0.020
pituitary cancer 1.900 0.000

Synonym

Accession Q9P0K1 O75075 O75076 Q9P0K2 Q9UIA1 Q9UKK2 ADAM 22
Symbols MDC2
ADAM 22

Gene

PDB

3G5C  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (14)

PMID Text
24227725 Disruption of LGI1-ADAM22 interaction reduces synaptic AMPA receptors in hippocampal neurons.
23810013 Data suggest that ADAM22 plays roles in cell differentiation, cell migration, and resistance to endocrine therapy in breast cancer; ADAM22 may serve as biomarker for poor disease-free survival in breast cancer patients. [REVIEW]
22072566 findings suggest that SRC-1 switches steroid-responsive tumors to a steroid-resistant state in which the SRC-1 target gene ADAM22 has a critical role
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20220021 Transgenic leucine-rich glioma-inactivated 4 (Lgi4) and transgenic Adam22 proteins are both expressed in Schwann cells as well as in sensory neurons; binding of Lgi4 to axonal Adam22 is required on axons to drive myelin formation.
20156119 Mutations in disintegrin domain sequence in ADAM22 gene is associted with reduced LGI4-binding abilities resulting in epilepsy.
19054571 Observational study of gene-disease association. (HuGE Navigator)
18593599 The pro domains of ADAMs are expressed as two subdomains. The most N-terminal subdomain (ADAM22-P(N)) was found to be susceptible to proteolysis and was required for folding stability of the second subdomain (ADAM22-P(C)).
18440780 our results suggest that neither ADAM22 nor any of the three Kv1 channel genes are major causative genes for ADLTE.
17884303 Differential coding potential of ADAM22 mRNAs.
More...

AA Sequence

MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDAL      1 - 70
DTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGH     71 - 140
IRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNIT    141 - 210
PSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQ    211 - 280
LKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICS    281 - 350
LLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIE    351 - 420
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLC    421 - 490
CKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQ    491 - 560
KVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQG    561 - 630
RTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKC    631 - 700
VCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLP    701 - 770
QGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLG    771 - 840
GNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI        841 - 906
//

Text Mined References (27)

PMID Year Title
24227725 2013 Autoantibodies to epilepsy-related LGI1 in limbic encephalitis neutralize LGI1-ADAM22 interaction and reduce synaptic AMPA receptors.
23810013 2013 ADAM22 as a prognostic and therapeutic drug target in the treatment of endocrine-resistant breast cancer.
22072566 2012 Global characterization of the SRC-1 transcriptome identifies ADAM22 as an ER-independent mediator of endocrine-resistant breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21221126 2012 Genome-wide association study of serious blistering skin rash caused by drugs.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20220021 2010 Adam22 is a major neuronal receptor for Lgi4-mediated Schwann cell signaling.
20156119 2010 Biological characterization of ADAM22 variants reveals the importance of a disintegrin domain sequence in cell surface expression.
19692335 2009 Structural characterization of the ectodomain of a disintegrin and metalloproteinase-22 (ADAM22), a neural adhesion receptor instead of metalloproteinase: insights on ADAM function.
More...