Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.13
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 8.7e-05
astrocytic glioma -1.200 3.6e-02
ependymoma -1.600 4.4e-02
lung cancer 1.100 8.3e-04
Multiple myeloma 1.229 2.5e-03
osteosarcoma -1.673 2.3e-05
ovarian cancer 2.100 1.1e-04
pancreatic cancer -1.100 3.4e-03
primary pancreatic ductal adenocarcinoma -1.017 5.1e-03
subependymal giant cell astrocytoma -1.634 3.8e-02

Gene RIF (4)

AA Sequence

MSRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAF      1 - 70
SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPR     71 - 140
DLDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMDPIAELLSQLSGVR    141 - 210
RSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTNIANTE    211 - 280
SSQQTLQNSQFLLTRLNDPKMSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAM    281 - 350
GCVDIMPLDVALENLNLKESNKGNEPPPPPL                                           351 - 381
//

Text Mined References (17)

PMID Year Title