Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.13
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.229 0.003
astrocytic glioma -1.200 0.036
ependymoma -1.600 0.044
osteosarcoma -1.673 0.000
primary pancreatic ductal adenocarcinoma -1.017 0.005
lung cancer 1.100 0.001
adult high grade glioma -1.100 0.000
subependymal giant cell astrocytoma -1.634 0.038
ovarian cancer 2.100 0.000
pancreatic cancer -1.100 0.003

Gene RIF (4)

PMID Text
25582440 Results showed KCMF1 C-terminus binds directly to RAD6, whereas N-terminal domains interact with UBR4 and point mutations found in X-linked intellectual disability (XLID) patients specifically lose the interaction with KCMF1 and UBR4.
24980667 Data indicate that expressions of miR-210 and potassium channel modulatory factor 1 (KCMF1) exhibited an inverse correlation in placentas from patients with severe preeclampsia.
16314831 Suppression of KCMF1 by constitutive high CD99 expression levels contribute to the malignant properties of Ewing's sarcoma by promoting growth and migration of tumor cells
15581609 Data indicate that FIGC upregulation in response to basic fibroblast growth factor in gastric cancer might be implicated in carcinogenesis through dysregulation of growth modulator.

AA Sequence

MSRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVDFDLYYGGEAF      1 - 70
SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHRAPR     71 - 140
DLDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSSSTGGLSSSQSSYSPSNREAMDPIAELLSQLSGVR    141 - 210
RSAGGQLNSSGPSASQLQQLQMQLQLERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTNIANTE    211 - 280
SSQQTLQNSQFLLTRLNDPKMSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAM    281 - 350
GCVDIMPLDVALENLNLKESNKGNEPPPPPL                                           351 - 381
//

Text Mined References (17)

PMID Year Title
25582440 2015 KCMF1 (potassium channel modulatory factor 1) Links RAD6 to UBR4 (ubiquitin N-recognin domain-containing E3 ligase 4) and lysosome-mediated degradation.
24980667 2014 MicroRNA-210 contributes to preeclampsia by downregulating potassium channel modulatory factor 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16314831 2006 Suppression of KCMF1 by constitutive high CD99 expression is involved in the migratory ability of Ewing's sarcoma cells.
More...