Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.36
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.098 0.000
ovarian cancer 1.300 0.016

Synonym

Accession Q9P0J6 A4UCS0 B2R4Z2 Q3SWV6 Q9UKL7 L36mt
Symbols RPMJ
BRIP1
L36mt
PRPL36
MRP-L36

Gene

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19318571 MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death.

AA Sequence

MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSIRGAAPVAVEPGAAVRSLLSPGLLPHLLPALGFKNKT      1 - 70
VLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM                                          71 - 103
//

Text Mined References (12)

PMID Year Title
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19318571 2009 Association of LETM1 and MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
More...