Property Summary

NCBI Gene PubMed Count 28
PubMed Score 173.67
PubTator Score 413.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 16 0.0 5.0

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy -1.588 2.1e-04
adult high grade glioma -1.800 1.3e-02
astrocytic glioma -1.100 3.7e-02
Astrocytoma, Pilocytic -1.600 2.9e-03
atypical teratoid / rhabdoid tumor -1.400 4.8e-03
autosomal dominant Emery-Dreifuss muscul... -1.414 1.1e-02
Becker muscular dystrophy -1.026 2.7e-02
Duchenne muscular dystrophy -1.254 6.9e-05
ependymoma -1.700 2.6e-02
glioblastoma -1.700 6.6e-04
group 3 medulloblastoma -2.200 1.9e-02
head and neck cancer and chronic obstruc... -1.200 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.8e-02
juvenile dermatomyositis -1.115 4.7e-06
limb girdle muscular dystrophy 2B -1.014 4.7e-03
malignant mesothelioma 1.100 2.3e-04
medulloblastoma, large-cell -2.900 6.0e-04
oligodendroglioma -1.900 1.5e-02
osteosarcoma 2.896 6.4e-08
ovarian cancer 1.500 1.3e-04
pancreatic cancer -1.100 6.6e-05
pancreatic carcinoma -1.100 6.6e-05
Parkinson's disease -1.600 2.0e-02
primitive neuroectodermal tumor -1.400 1.4e-02
ulcerative colitis 1.700 2.4e-04

Gene RIF (12)

AA Sequence

MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRR      1 - 70
YASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLL     71 - 140
GVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFN    141 - 210
SLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD    211 - 280
GVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPF    281 - 350
RAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL    351 - 420
WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNN    421 - 490
EFGTVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE                           491 - 537
//

Text Mined References (31)

PMID Year Title