Property Summary

NCBI Gene PubMed Count 27
PubMed Score 163.89
PubTator Score 413.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 5.99916490754631E-9
osteosarcoma 7933 6.35697681116736E-8
juvenile dermatomyositis 1189 4.71908906821973E-6
medulloblastoma 1524 1.05089857497049E-5
pancreatic carcinoma 567 6.57624430604365E-5
pancreatic cancer 2300 6.57624430604368E-5
Duchenne muscular dystrophy 602 6.89219434400602E-5
ovarian cancer 8492 1.30019619426958E-4
acute quadriplegic myopathy 1157 2.10134463189541E-4
malignant mesothelioma 3163 2.27629752702831E-4
medulloblastoma, large-cell 6234 6.04127987479903E-4
ulcerative colitis 2087 0.00177814353283293
astrocytic glioma 2241 0.00179528774851931
pilocytic astrocytoma 3086 0.00263227369845122
glioblastoma 5572 0.00280030727690295
ependymoma 2514 0.00300264049125203
limb girdle muscular dystrophy 2I 56 0.0107475306620378
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0108796207133082
adult high grade glioma 2148 0.0126383838373007
primitive neuroectodermal tumor 3031 0.0136536726765773
oligodendroglioma 2849 0.0154215265293043
Parkinson's disease 364 0.0196802285350589
head and neck cancer and chronic obstructive pulmonary disease 237 0.0223475061600929
Becker muscular dystrophy 187 0.0271914558609313
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.038346601063696
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 15 0.0 5.0

Expression

Synonym

Accession Q9P0J1 B3KX71 J3KPU0 Q5U5K1 PDP 1
Symbols PDH
PDP
PDPC
PPM2A
PPM2C

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (11)

PMID Text
24962578 YB-1 phosphorylation at Ser-102 is an important prerequisite for CCL5 promoter activation during macrophage differentiation
24486017 the pyruvate dehydrogenase complex is regulated by Tyr phosphorylation of PDP1, which toggles recruitment between ACAT1 and SIRT3
21680880 Although 7 days of bed rest induced whole body glucose intolerance, exercise-induced PDH regulation in skeletal muscle was not changed, suggesting that exercise-induced PDH regulation in skeletal muscle is maintained in glucose-intolerant individuals.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20208177 catalytic subunit of PDP1 crystals belonged to space group P4(1)2(1)2 or P4(3)2(1)2, with unit-cell parameters a = b = 65.1, c = 216.1 A.
16188909 Lower accumulation of free ADP and AMP after the FAT-adapt trial may be responsible for the decreased glycogenolysis and PDH activation during sprinting.
15897476 pyruvate dehydrogenase phosphatase PDP1 is down-regulated in circulating lymphocytes of obese subjects because it is poorly sensitive to magnesium/calcium; this defect is attenuated when plasma insulin is greatly enhanced
9651365 Functional characterization of the rat counterpart.
8396421 Functional characterization of the bovine counterpart.
1327585 In cultured skin fibroblasts from three patients with congenital lactic acidemia due to a defect in activation of the pyruvate dehydrogenase complex, the PDP-activity was significantly reduced to 50.7%, 64.6% and 63.1% of that of control fibroblasts.
More...

AA Sequence

MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRR      1 - 70
YASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLL     71 - 140
GVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFN    141 - 210
SLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD    211 - 280
GVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPF    281 - 350
RAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL    351 - 420
WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNN    421 - 490
EFGTVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE                           491 - 537
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24962578 2014 Tyr-94 phosphorylation inhibits pyruvate dehydrogenase phosphatase 1 and promotes tumor growth.
24486017 2014 Tyr phosphorylation of PDP1 toggles recruitment between ACAT1 and SIRT3 to regulate the pyruvate dehydrogenase complex.
21680880 2011 Exercise-induced pyruvate dehydrogenase activation is not affected by 7 days of bed rest.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20208177 2010 Crystallization and preliminary crystallographic studies of the catalytic subunits of human pyruvate dehydrogenase phosphatase isoforms 1 and 2.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19184109 2009 Pyruvate dehydrogenase phosphatase 1 (PDP1) null mutation produces a lethal infantile phenotype.
More...