Property Summary

Ligand Count 1
NCBI Gene PubMed Count 75
PubMed Score 79.05
PubTator Score 75.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.100 2.7e-03
Multiple myeloma 2.280 3.1e-05
ovarian cancer 3.100 1.7e-07
Polycystic ovary syndrome 1.241 5.5e-03
Waldenstrons macroglobulinemia 1.292 5.4e-03

 GWAS Trait (1)

Gene RIF (53)

AA Sequence

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIA      1 - 70
LLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGF     71 - 140
MWYT                                                                      141 - 144
//

Text Mined References (81)

PMID Year Title