Property Summary

NCBI Gene PubMed Count 68
Grant Count 25
R01 Count 10
Funding $1,741,828.27
PubMed Score 74.08
PubTator Score 75.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.292 0.005
Multiple myeloma 2.280 0.000
lung cancer 1.100 0.003
Polycystic Ovary Syndrome 1.241 0.005
ovarian cancer 3.100 0.000

Gene RIF (47)

PMID Text
26769301 Aberrant endometrial expression of GRIM-19 was associated with adenomyosis through the regulation of apoptosis and angiogenesis.
26458553 Transfection with eukaryotic plasmid for the simultaneous expression of GRIM19 and LKB1 more effectively suppressed the growth of breast cancer in vitro and in vivo, and may therefore have therapeutic potential for the treatment of human breast cancer.
26363526 GRIM-19 expression is closely associated with colorectal cancer progression and might be a very promising prognostic biomarker
26188382 Data suggest that tumor expression of Ki67 (antigen Ki-67) and GRIM19 correlate with malignancy in thyroid Hurthle cell (HC) tumors; variable expression of Ki67 and GRIM19 may helped differentiate HC carcinoma from HC adenoma.
26011333 High expression of GW112 in colorectal cancer tissues and reduced expression of GRIM-19 in colorectal cancer tissues may be associated with abnormal proliferation of cancer cells.
25955394 Upregulation of GRIM-19 also suppressed the secretion of urokinase-type plasminogen activator (u-PA), matrix metalloproteinase (MMP)-2, MMP-9 and vascular endothelial growth factor (VEGF).
25901006 We established here a correlation between the first mutation identified in the NDUFA13 gene, which induces Mitochondrial complex I instability and a severe but slowly evolving clinical presentation affecting the central nervous system.
25575809 decreased GRIM-19 expression due to promoter hypermethylation may be important in head and neck carcinogenesis by promoting cell proliferation and regulating metabolic activity
25455534 The GRIM-19 deficiency in the villus may be associated with missed abortion via increasing apoptosis and affecting angiogenesis.
25242535 Simultaneous expression of ADAM10-specific siRNA and GRIM19 in HepG2 cancer cells significantly inhibited the proliferation, migration and invasion.
More...

AA Sequence

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIA      1 - 70
LLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGF     71 - 140
MWYT                                                                      141 - 144
//

Text Mined References (74)

PMID Year Title
26769301 2016 Expression of GRIM-19 in adenomyosis and its possible role in pathogenesis.
26458553 2015 Additive effects of eukaryotic co?expression plasmid carrying GRIM?19 and LKB1 genes on breast cancer in vitro and in vivo.
26363526 2015 GRIM-19 expression is a potent prognostic marker in colorectal cancer.
26188382 2016 Thyroid Hürthle cell tumors: research of potential markers of malignancy.
26011333 Expression of GW112 and GRIM-19 in colorectal cancer tissues.
25955394 2015 Upregulation of GRIM-19 inhibits the growth and invasion of human breast cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901006 2015 Mutation in NDUFA13/GRIM19 leads to early onset hypotonia, dyskinesia and sensorial deficiencies, and mitochondrial complex I instability.
25575809 2015 Decreased expression of GRIM-19 by DNA hypermethylation promotes aerobic glycolysis and cell proliferation in head and neck squamous cell carcinoma.
25455534 2015 Expression of GRIM-19 in missed abortion and possible pathogenesis.
More...