Property Summary

NCBI Gene PubMed Count 11
PubMed Score 58.56
PubTator Score 17.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.45180159384472E-9
osteosarcoma 7933 4.67786820499797E-6
medulloblastoma, large-cell 6234 1.24507655498926E-5
medulloblastoma 1524 6.99905327768266E-5
glioblastoma 5572 2.39581879144422E-4
adult high grade glioma 2148 3.44289438471702E-4
ovarian cancer 8492 3.73422861024549E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0013328422431402
primitive neuroectodermal tumor 3031 0.00161285834622913
Multiple myeloma 1328 0.00848841948034834
astrocytic glioma 2241 0.0125416356250978
ependymoma 2514 0.0287491728869675
Breast cancer 3099 0.0354101371960353
oligodendroglioma 2849 0.0408119289098628
Disease Target Count Z-score Confidence
Amyloidosis 68 4.268 2.1
Microsporidiosis 12 3.437 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.092 0.008
astrocytic glioma -1.600 0.013
ependymoma -1.500 0.029
oligodendroglioma -1.200 0.041
osteosarcoma -2.261 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.300 0.002
pancreatic ductal adenocarcinoma liver m... -1.196 0.001
Breast cancer 1.900 0.035
adult high grade glioma -1.200 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q9P0I2 B2R4Z9 Q53GH8 Q6ZMC2
Symbols POB
TMEM111

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPK      1 - 70
QSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKV     71 - 140
PFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAM    141 - 210
PADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF                       211 - 261
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
19797678 2009 Coexpression network based on natural variation in human gene expression reveals gene interactions and functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...