Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $44,996.2
PubMed Score 22.34
PubTator Score 36.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.091 0.000

Synonym

Accession Q9P0G3 A7UNK5 Q1RMZ2 Q6B089 hK14
Symbols KLK-L6

Gene

 Grant Application (1)

Gene RIF (23)

PMID Text
23224034 KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients.
22505524 KLK8 and KLK14 can signal differentially via the PARs to affect tissue function
22505523 KLK14, acting via PAR-2, represents an autocrine/paracrine regulator of colon tumorigenesis
22505522 genetic variants in the KLK14 locus are associated with risk and/or aggressiveness of prostate cancer
21057706 KLK14 gene expression could be evaluated as a putative independent diagnostic biomarker in breast tumour biopsies.
20424135 Observational study of gene-disease association. (HuGE Navigator)
20155713 The differences in the levels of KLK14 suggest that KLKs may aid in the differential diagnosis of salivary gland tumors. The coexpression of KLKs suggests their possible involvement in an enzymatic pathway activated in salivary gland.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19383315 synergistic effects between estrogens and androgens on estrogen-sensitive genes may have implications on the role of the kallikreins 10, 11, and 14 in associated risk of breast cancer and progression.
19147544 KLK4 is only expressed in breast and prostate cancers that express the progesterone receptor (PR) and androgen receptor (AR), respectively.
More...

AA Sequence

MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGG      1 - 70
ALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIG     71 - 140
RAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQ    141 - 210
GGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK                 211 - 267
//

Text Mined References (36)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23224034 2013 Parallel overexpression and clinical significance of kallikrein-related peptidases 7 and 14 (KLK7KLK14) in colon cancer.
22505524 2012 Proteinase-activated receptors (PARs): differential signalling by kallikrein-related peptidases KLK8 and KLK14.
22505523 2012 Kallikrein-related peptidase signaling in colon carcinoma cells: targeting proteinase-activated receptors.
22505522 2012 The kallikrein 14 gene is down-regulated by androgen receptor signalling and harbours genetic variation that is associated with prostate tumour aggressiveness.
21057706 2011 Quantitative expression analysis and study of the novel human kallikrein-related peptidase 14 gene (KLK14) in malignant and benign breast tissues.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20155713 Human kallikrein 14 (KLK14) expression in salivary gland tumors.
19558318 2009 Association between kallikrein-related peptidases (KLKs) and macroscopic indicators of semen analysis: their relation to sperm motility.
19383315 2008 Androgens act synergistically to enhance estrogen-induced upregulation of human tissue kallikreins 10, 11, and 14 in breast cancer cells via a membrane bound androgen receptor.
More...