Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFL      1 - 70
RQENRKNMLLSVAIFILLTLVYAYWTM                                                71 - 97
//

Text Mined References (8)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21269460 2011 Initial characterization of the human central proteome.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.