Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.91930139081617E-17
Breast cancer 3099 8.80282237208948E-13
invasive ductal carcinoma 2950 2.3142461286731E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00109820829362277
ductal carcinoma in situ 1745 0.0012629743760149
group 3 medulloblastoma 2254 0.00216514486967803
non primary Sjogren syndrome sicca 840 0.0153466464139837
Disease Target Count Z-score Confidence
Exfoliation syndrome 8 3.915 2.0

Expression

Synonym

Accession Q9P0B6 Q5T7F7 Q9BTQ9
Symbols HSPC265
C6orf129

Gene

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFL      1 - 70
RQENRKNMLLSVAIFILLTLVYAYWTM                                                71 - 97
//

Text Mined References (8)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21269460 2011 Initial characterization of the human central proteome.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.