Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.30
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9P0B6 Q5T7F7 Q9BTQ9
Symbols HSPC265
C6orf129

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFL      1 - 70
RQENRKNMLLSVAIFILLTLVYAYWTM                                                71 - 97
//

Text Mined References (8)

PMID Year Title