Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $6,714.29
PubMed Score 5.46
PubTator Score 10.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.746 0.000
diabetes mellitus -1.200 0.001

Synonym

Accession Q9P086 Q6NS89
Symbols HSPC296

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
25100719 Knockdown of MED11 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
25100719 Knockdown of mediator complex subunit 11 (MED11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18976975 Knockdown of MED11 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 11 (MED11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYL      1 - 70
TQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN                            71 - 117
//

Text Mined References (7)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.