Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.46
PubTator Score 10.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-06
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Cataract 8 multiple types 33 4.863 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.0e-03
osteosarcoma -1.746 1.6e-06

Synonym

Accession Q9P086 Q6NS89
Symbols HSPC296

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYL      1 - 70
TQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN                            71 - 117
//

Text Mined References (7)

PMID Year Title