Tbio | JNK1/MAPK8-associated membrane protein |
May be a regulator of the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) luminal proteins through the recruitment of components of the proteasome and endoplasmic reticulum-associated degradation (ERAD) system (By similarity).
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 1.44092131208826E-6 |
tuberculosis and treatment for 6 months | 686 | 7.29458413744545E-5 |
Pick disease | 1893 | 5.24251929848284E-4 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0199069559310461 |
medulloblastoma, large-cell | 6234 | 0.0238194281214629 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.0368897005268313 |
Disease | log2 FC | p |
---|---|---|
medulloblastoma, large-cell | -1.200 | 0.024 |
pancreatic ductal adenocarcinoma liver m... | -1.598 | 0.037 |
tuberculosis and treatment for 6 months | 1.200 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 1.500 | 0.020 |
Pick disease | -1.100 | 0.001 |
ovarian cancer | -2.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
C. elegans | OMA Inparanoid |
Fruitfly | EggNOG Inparanoid |
PMID | Text |
---|---|
25173965 | synergistic function of Jnk1 in haematopoietic cells and hepatocytes might be relevant for the development of chronic liver injury |
23798571 | Expression of DP, a receptor largely retained in the ER, promoted proteasome recruitment by JAMP. |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
19269966 | RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP. |
18784250 | JAMP is an important component for coordinated clearance of misfolded proteins from the endoplasmic reticulum. |
16166642 | Identification and functional characterization of the mouse Jamp ortholog. |
MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPEL 1 - 70 YDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLML 71 - 140 SDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAA 141 - 210 LYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGI 211 - 280 ISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH 281 - 326 //
PMID | Year | Title |
---|---|---|
25173965 | 2015 | Haematopoietic cell-derived Jnk1 is crucial for chronic inflammation and carcinogenesis in an experimental model of liver injury. |
23798571 | 2013 | Novel, gel-free proteomics approach identifies RNF5 and JAMP as modulators of GPCR stability. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
19269966 | 2009 | Regulation of endoplasmic reticulum-associated degradation by RNF5-dependent ubiquitination of JNK-associated membrane protein (JAMP). |
18784250 | 2008 | JAMP optimizes ERAD to protect cells from unfolded proteins. |
16381901 | 2006 | The LIFEdb database in 2006. |
16166642 | 2005 | JAMP, a Jun N-terminal kinase 1 (JNK1)-associated membrane protein, regulates duration of JNK activity. |
15489336 | 2004 | From ORFeome to biology: a functional genomics pipeline. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
More... |