Property Summary

NCBI Gene PubMed Count 19
PubMed Score 75.94
PubTator Score 13.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.373 7.6e-07
aldosterone-producing adenoma -1.335 4.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.081 2.4e-03
breast carcinoma 1.100 3.4e-13
Down syndrome 1.600 6.3e-04
ductal carcinoma in situ 1.400 4.1e-03
interstitial cystitis -1.600 6.2e-04
intraductal papillary-mucinous adenoma (... 1.300 5.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.5e-02
invasive ductal carcinoma 2.000 5.0e-03
juvenile dermatomyositis 1.272 7.5e-12
lung adenocarcinoma 1.394 4.9e-07
lung cancer 1.700 1.1e-03
lung carcinoma 1.800 2.8e-28
non-small cell lung cancer 1.231 4.1e-12
osteosarcoma 1.833 1.6e-03
ovarian cancer -1.200 2.6e-05
pancreatic cancer 1.100 4.5e-02
Pick disease -1.200 4.2e-03
psoriasis -1.700 1.1e-04
urothelial carcinoma -1.100 2.3e-02

Gene RIF (7)

AA Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPV      1 - 70
YKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPE     71 - 140
TLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVT    141 - 210
TSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYT    211 - 280
LWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQR    281 - 350
RRRYGQKKKKIH                                                              351 - 362
//

Text Mined References (35)

PMID Year Title