Property Summary

NCBI Gene PubMed Count 19
PubMed Score 72.49
PubTator Score 13.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.82519144994807E-28
breast carcinoma 1614 3.36535097982855E-13
non-small cell lung cancer 2798 4.07244157169584E-12
juvenile dermatomyositis 1189 2.66327833136196E-11
lung adenocarcinoma 2714 4.89701882212937E-7
osteosarcoma 7933 6.57037429088245E-7
acute quadriplegic myopathy 1157 2.78805613390195E-6
ovarian cancer 8492 8.22590317772868E-5
psoriasis 6685 1.1331451490388E-4
interstitial cystitis 2299 6.21364242865138E-4
Down syndrome 548 6.33855972767717E-4
lung cancer 4473 0.00113097065654128
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00226768375342796
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00241794641035154
ductal carcinoma in situ 1745 0.00407251163421471
Pick disease 1893 0.00424888204827101
invasive ductal carcinoma 2950 0.00503223993289879
urothelial carcinoma 318 0.0232395784014101
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0343969233074086
aldosterone-producing adenoma 664 0.0423918108081183
pancreatic cancer 2300 0.0453477463171532

Expression

Synonym

Accession Q9P035 A0PJA1 B4DRF4 Q280Z3 Q6PD63 Q8IUI5 Q8NC86 Q8NCB1 Q96T12 Q9NQA7
Symbols BIND1
B-IND1
HSPC121
PTPLAD1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (7)

PMID Text
25687571 Our results indicate that PTPLAD1 (HACD3) is in complex with insulin receptor (IR) in rat's liver and in human HEK293 cells. SiRNA-mediated partial knockdown of PTPLAD1 increased level of IR tyrosine phosphorylation and affect IR endocytosis. PTPLAD1 depletion strongly enhanced insulin effect on Glut2 translocation in HEK293 cells similar to the increase in AKT-ser473 phosphorylation. [PTPLAD1]
23125841 Tandem affinity purification and mass spectrometry analysis identify protein tyrosine phosphatase-like A domain containing 1 (PTPLAD1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22560525 Genes in the erythroid differentiation and cell cycle regulation pathways influence interindividual variation in RBC indices. Our results provide insights into the molecular basis underlying variation in RBC traits.
22190034 Tandem affinity purification and mass spectrometry analysis identify protein tyrosine phosphatase-like A domain containing 1 (PTPLAD1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19656872 These results suggest that an Hsp90-dependent chaperone pathway incorporating hB-ind1 is involved in protein folding in the membranous web for the circumvention of the UPR and that it facilitates HCV replication
18160438 results suggest that hB-ind1 plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins
16516406 The structure of the B-IND1 gene promoter region was determined.

AA Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPV      1 - 70
YKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPE     71 - 140
TLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIGVT    141 - 210
TSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYT    211 - 280
LWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQR    281 - 350
RRRYGQKKKKIH                                                              351 - 362
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22560525 2012 Genetic Loci implicated in erythroid differentiation and cell cycle regulation are associated with red blood cell traits.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...