Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.71
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 5.1e-07
osteosarcoma 7950 5.3e-05
Multiple myeloma 1332 6.4e-03
ovarian cancer 8519 2.0e-02

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 5.1e-07
Multiple myeloma 1.301 6.4e-03
osteosarcoma 1.527 5.3e-05
ovarian cancer 1.100 2.0e-02

Synonym

Accession Q9P031 Q9H2V5 Q9NW62 TTF-1-associated protein 26
Symbols BR22
TAP26
HSPC128

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

AA Sequence

MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRKLKIQQSYKKL      1 - 70
LRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCS     71 - 140
FDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKME    141 - 210
VFKILNKKTKKGQPNLNVQMEYLLQKIQEKC                                           211 - 241
//

Text Mined References (14)

PMID Year Title