Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.71
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Hypospadias 65
Disease Target Count P-value
malignant mesothelioma 3163 5.11418666979883E-7
osteosarcoma 7933 5.33741897210722E-5
Multiple myeloma 1328 0.0063635870444092
ovarian cancer 8492 0.0198425255664318

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.301 0.006
malignant mesothelioma 1.300 0.000
osteosarcoma 1.527 0.000
ovarian cancer 1.100 0.020

Synonym

Accession Q9P031 Q9H2V5 Q9NW62 TTF-1-associated protein 26
Symbols BR22
TAP26
HSPC128

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

AA Sequence

MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRKLKIQQSYKKL      1 - 70
LRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCS     71 - 140
FDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKME    141 - 210
VFKILNKKTKKGQPNLNVQMEYLLQKIQEKC                                           211 - 241
//

Text Mined References (14)

PMID Year Title
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16630564 2006 The TTF-1/TAP26 complex differentially modulates surfactant protein-B (SP-B) and -C (SP-C) promoters in lung cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882447 2003 BR22, a 26 kDa thyroid transcription factor-1 associated protein (TAP26), is expressed in human lung cells.
More...