Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $192,200
PubMed Score 3.71
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.301 0.006
malignant mesothelioma 1.300 0.000
osteosarcoma 1.527 0.000
ovarian cancer 1.100 0.020

Synonym

Accession Q9P031 Q9H2V5 Q9NW62 TTF-1-associated protein 26
Symbols BR22
TAP26
HSPC128

Gene

AA Sequence

MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRKLKIQQSYKKL      1 - 70
LRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCS     71 - 140
FDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKME    141 - 210
VFKILNKKTKKGQPNLNVQMEYLLQKIQEKC                                           211 - 241
//

Text Mined References (14)

PMID Year Title
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16630564 2006 The TTF-1/TAP26 complex differentially modulates surfactant protein-B (SP-B) and -C (SP-C) promoters in lung cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882447 2003 BR22, a 26 kDa thyroid transcription factor-1 associated protein (TAP26), is expressed in human lung cells.
More...