Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.74
PubTator Score 9.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Synonym

Accession Q9P021
Symbols SSMDF
HSPC139

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS      1 - 70
HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV                                            71 - 101
//

Text Mined References (21)

PMID Year Title