Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 2
Funding $689,117.91
PubMed Score 12.23
PubTator Score 9.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20398908 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGS      1 - 70
HYCQGCAYKKGICAMCGKKVLDTKNYKQTSV                                            71 - 101
//

Text Mined References (19)

PMID Year Title
24389050 2014 Genomic analysis of primordial dwarfism reveals novel disease genes.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17474715 2007 A thermodynamic ligand binding study of the third PDZ domain (PDZ3) from the mammalian neuronal protein PSD-95.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16637659 2006 Uncovering quantitative protein interaction networks for mouse PDZ domains using protein microarrays.
16091592 2005 The interaction between PSD-95 and Ca2+/calmodulin is enhanced by PDZ-binding proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...