Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.58
PubTator Score 6.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.089 0.005
Multiple myeloma 1.134 0.002
osteosarcoma -1.335 0.000
cystic fibrosis 1.089 0.000
tuberculosis and treatment for 6 months -1.300 0.006
lung cancer 1.900 0.000
ovarian cancer 1.900 0.000

Gene RIF (3)

PMID Text
19237743 The 2.3A-resolution structure revealed only one 2-fold axis of rotational pseudosymmetry. A potential RNA-binding domain from human YTH-domain-containing protein 2 has the most similar 3-D fold to that of the DUF55 domain; it may be an RNA-related domain.
15939300 HSPC144 was expressed and purified, and a stable fragment (residues 44-225) was identified by limited proteolysis method.
12384300 Studies of the mouse counterpart.

AA Sequence

MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG      1 - 70
VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF     71 - 140
EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ    141 - 210
EEFDFVLSLEEKEPS                                                           211 - 225
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19237743 2009 Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15939300 2005 Identification, expression, and purification of a unique stable domain from human HSPC144 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14601557 2003 Anti-IgM-induced down-regulation of nuclear Thy28 protein expression in Ramos B lymphoma cells.
14580360 2003 Modulation of mThy28 nuclear protein expression during thymocyte development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...