Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.58
PubTator Score 6.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis 1.089 4.8e-05
lung cancer 1.900 1.8e-04
Multiple myeloma 1.134 1.9e-03
osteosarcoma -1.335 2.9e-04
ovarian cancer -1.400 3.9e-06
tuberculosis and treatment for 6 months -1.300 6.3e-03
Waldenstrons macroglobulinemia 1.089 4.8e-03

Synonym

Accession Q9P016 Q567Q2 Q9H3L4 Q9HC20
Symbols MY105
THY28
MDS012
HSPC144
THY28KD

Gene

PDB

3EOP   5J3E  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG      1 - 70
VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF     71 - 140
EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ    141 - 210
EEFDFVLSLEEKEPS                                                           211 - 225
//

Text Mined References (14)

PMID Year Title