Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 7.38697337560254E-16
ovarian cancer 8492 1.3648800114778E-4
lung cancer 4473 7.59834938055664E-4
Pick disease 1893 0.00300164303903797
Multiple myeloma 1328 0.00329330822225973
acute myeloid leukemia 785 0.00567618490906407
Breast cancer 3099 0.0215258560780546
astrocytic glioma 2241 0.0221107499752975
colon cancer 1475 0.0442550124018876

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.406 0.003
astrocytic glioma -1.200 0.022
non-small cell lung cancer 1.040 0.000
colon cancer -1.300 0.044
lung cancer 1.600 0.001
Breast cancer 4.200 0.022
Pick disease -1.100 0.003
acute myeloid leukemia -1.600 0.006
ovarian cancer 2.200 0.000

Synonym

Accession Q9P015 Q96Q54 Q9H0Y1 L15mt
Symbols L15mt
RPML7
MRP-L7
HSPC145
MRP-L15

Gene

PDB

3J9M   3J7Y  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGPLQGGGARALDLLRGLPRVSLANLKPNPGSKKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGG      1 - 70
QTPFYIRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQLVNGRGVTIQPLKRDYGVQL     71 - 140
VEEGADTFTAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLDIVCKPVPFFLRGQPIPKRMLPPEEL    141 - 210
VPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADK    211 - 280
KILKPTDENLLKYYTS                                                          281 - 296
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16381901 2006 The LIFEdb database in 2006.
More...