Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.406 0.003
astrocytic glioma -1.200 0.022
non-small cell lung cancer 1.040 0.000
colon cancer -1.300 0.044
lung cancer 1.600 0.001
Breast cancer 4.200 0.022
Pick disease -1.100 0.003
acute myeloid leukemia -1.600 0.006
ovarian cancer 2.200 0.000

Synonym

Accession Q9P015 Q96Q54 Q9H0Y1 L15mt
Symbols L15mt
RPML7
MRP-L7
HSPC145
MRP-L15

Gene

PDB

3J9M   3J7Y  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGPLQGGGARALDLLRGLPRVSLANLKPNPGSKKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGG      1 - 70
QTPFYIRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQLVNGRGVTIQPLKRDYGVQL     71 - 140
VEEGADTFTAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLDIVCKPVPFFLRGQPIPKRMLPPEEL    141 - 210
VPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADK    211 - 280
KILKPTDENLLKYYTS                                                          281 - 296
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16381901 2006 The LIFEdb database in 2006.
More...