Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.600 5.7e-03
astrocytic glioma -1.200 2.2e-02
Breast cancer 4.200 2.2e-02
colon cancer -1.300 4.4e-02
lung cancer 1.600 7.6e-04
Multiple myeloma 1.406 3.3e-03
non-small cell lung cancer 1.040 7.4e-16
ovarian cancer 2.200 1.4e-04
Pick disease -1.100 3.0e-03

Synonym

Accession Q9P015 Q96Q54 Q9H0Y1 L15mt
Symbols L15mt
RPML7
MRP-L7
HSPC145
MRP-L15

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAGPLQGGGARALDLLRGLPRVSLANLKPNPGSKKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGG      1 - 70
QTPFYIRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQLVNGRGVTIQPLKRDYGVQL     71 - 140
VEEGADTFTAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLDIVCKPVPFFLRGQPIPKRMLPPEEL    141 - 210
VPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADK    211 - 280
KILKPTDENLLKYYTS                                                          281 - 296
//

Text Mined References (22)

PMID Year Title