Tbio | 39S ribosomal protein L15, mitochondrial |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the EcoL15 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 15q. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 7.38697337560254E-16 |
ovarian cancer | 8492 | 1.3648800114778E-4 |
lung cancer | 4473 | 7.59834938055664E-4 |
Pick disease | 1893 | 0.00300164303903797 |
Multiple myeloma | 1328 | 0.00329330822225973 |
acute myeloid leukemia | 785 | 0.00567618490906407 |
Breast cancer | 3099 | 0.0215258560780546 |
astrocytic glioma | 2241 | 0.0221107499752975 |
colon cancer | 1475 | 0.0442550124018876 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.406 | 0.003 |
astrocytic glioma | -1.200 | 0.022 |
non-small cell lung cancer | 1.040 | 0.000 |
colon cancer | -1.300 | 0.044 |
lung cancer | 1.600 | 0.001 |
Breast cancer | 4.200 | 0.022 |
Pick disease | -1.100 | 0.003 |
acute myeloid leukemia | -1.600 | 0.006 |
ovarian cancer | 2.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
MAGPLQGGGARALDLLRGLPRVSLANLKPNPGSKKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGG 1 - 70 QTPFYIRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQLVNGRGVTIQPLKRDYGVQL 71 - 140 VEEGADTFTAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLDIVCKPVPFFLRGQPIPKRMLPPEEL 141 - 210 VPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADK 211 - 280 KILKPTDENLLKYYTS 281 - 296 //
PMID | Year | Title |
---|---|---|
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25278503 | 2014 | Structure of the large ribosomal subunit from human mitochondria. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
21516116 | 2011 | Next-generation sequencing to generate interactome datasets. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. |
16381901 | 2006 | The LIFEdb database in 2006. |
More... |