Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.05
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 1.100 2.4e-12
atypical teratoid / rhabdoid tumor 1.200 4.2e-05
Breast cancer 2.700 2.8e-02
breast carcinoma 1.100 2.8e-22
dermatomyositis 1.600 2.8e-03
ependymoma 1.300 2.6e-06
glioblastoma 1.800 6.2e-08
group 3 medulloblastoma 2.100 8.2e-04
hepatocellular carcinoma 1.100 6.9e-06
intraductal papillary-mucinous neoplasm ... 1.300 1.2e-02
invasive ductal carcinoma 1.100 4.1e-02
lung cancer 1.300 2.1e-03
medulloblastoma, large-cell 1.600 8.8e-05
Multiple myeloma 1.481 2.9e-03
oligodendroglioma 1.200 4.6e-10
ovarian cancer -1.200 7.6e-04
pancreatic cancer 1.100 1.2e-04
pediatric high grade glioma 1.900 4.2e-06
primary pancreatic ductal adenocarcinoma 1.858 8.2e-04
primitive neuroectodermal tumor 1.300 1.0e-02
ulcerative colitis -1.300 6.1e-08
Waldenstrons macroglobulinemia 1.020 4.5e-02

Gene RIF (1)

AA Sequence

MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFI      1 - 70
FLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND      71 - 139
//

Text Mined References (16)

PMID Year Title