Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.05
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P003 A8K1Q8 B2R553 Q9H0X8 CNIH-4
Symbols CNIH-4
HSPC163

Gene

PANTHER Protein Class (1)

AA Sequence

MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFI      1 - 70
FLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND      71 - 139
//

Text Mined References (15)

PMID Year Title
24405750 2014 CNIH4 interacts with newly synthesized GPCR and controls their export from the endoplasmic reticulum.
21269460 2011 Initial characterization of the human central proteome.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...