Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.42
PubTator Score 15.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
juvenile dermatomyositis 1189 4.25370145176482E-9
diabetes mellitus 1663 0.00104821351867176
osteosarcoma 7933 0.00117607260852364
primary Sjogren syndrome 789 0.00373857883050331
Multiple Sclerosis 498 0.0127692773321875
dermatomyositis 967 0.0165784329231214
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0254053556959135

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.059 0.001
juvenile dermatomyositis 1.364 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.025
diabetes mellitus -1.100 0.001
Multiple Sclerosis 1.100 0.013
primary Sjogren syndrome 1.100 0.004
dermatomyositis 1.200 0.017

Synonym

Accession Q9NZZ3 B2RD95 B4DIR6 Q5VXW2 Q96AV2 Q9HB68 Q9NYS4 Q9Y323
Symbols Vps60
CGI-34
PNAS-2
C9orf83
HSPC177
SNF7DC2

Gene

PANTHER Protein Class (1)

PDB

2LXM   3ULY   3UM0   3UM1   3UM2   4TXR  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
26821576 CHMP5 might be involved in the homeostatic regulation of TCR on the cell surface, presumably through TCR recycling or degradation. Thus CHMP5 is implicated in TCR-mediated signaling.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
23619569 after CHMP5 inhibition, both Granzyme B/Perforin apoptotic pathway and apoptosis-inducing factor-mediated necrotic pathway were activated, while autophagic pathway was not activated
22082156 Knockdown of charged multivesicular body protein 5 (CHMP5) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18426649 pnas-2 is specifically up-regulated in acute leukemia patients.
17855796 PNAS-2 was shown to be anti-apoptotic and may participate in leukemogenesis
17708794 The pnas-2 gene may be closely related with apotosis of arsenic sulfide treated APL cells.

AA Sequence

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK      1 - 70
QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME     71 - 140
DANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDE    141 - 210
FGLPQIPAS                                                                 211 - 219
//

Text Mined References (42)

PMID Year Title
26821576 2016 Charged MVB protein 5 is involved in T-cell receptor signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23619569 2013 The role of charged multivesicular body protein 5 in programmed cell death in leukemic cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
More...