Property Summary

NCBI Gene PubMed Count 35
PubMed Score 24.25
PubTator Score 15.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.200 1.7e-02
diabetes mellitus -1.100 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.5e-02
juvenile dermatomyositis 1.364 4.3e-09
Multiple Sclerosis 1.100 1.3e-02
osteosarcoma 1.059 1.2e-03
primary Sjogren syndrome 1.100 3.7e-03

 GO Function (1)

Protein-protein Interaction (8)

Gene RIF (7)

AA Sequence

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK      1 - 70
QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME     71 - 140
DANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDE    141 - 210
FGLPQIPAS                                                                 211 - 219
//

Text Mined References (42)

PMID Year Title