Property Summary

NCBI Gene PubMed Count 35
Grant Count 15
R01 Count 8
Funding $1,216,629.33
PubMed Score 21.42
PubTator Score 15.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.059 0.001
juvenile dermatomyositis 1.364 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.025
diabetes mellitus -1.100 0.001
Multiple Sclerosis 1.100 0.013
primary Sjogren syndrome 1.100 0.004
dermatomyositis 1.200 0.017

Gene RIF (7)

PMID Text
26821576 CHMP5 might be involved in the homeostatic regulation of TCR on the cell surface, presumably through TCR recycling or degradation. Thus CHMP5 is implicated in TCR-mediated signaling.
25637630 ESCRT-III protein CHMP5 inhibits LIP5-mediated VPS4 activation by inducing a moderate conformational change within LIP5.
23619569 after CHMP5 inhibition, both Granzyme B/Perforin apoptotic pathway and apoptosis-inducing factor-mediated necrotic pathway were activated, while autophagic pathway was not activated
22082156 Knockdown of charged multivesicular body protein 5 (CHMP5) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18426649 pnas-2 is specifically up-regulated in acute leukemia patients.
17855796 PNAS-2 was shown to be anti-apoptotic and may participate in leukemogenesis
17708794 The pnas-2 gene may be closely related with apotosis of arsenic sulfide treated APL cells.

AA Sequence

MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK      1 - 70
QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME     71 - 140
DANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDE    141 - 210
FGLPQIPAS                                                                 211 - 219
//

Text Mined References (42)

PMID Year Title
26821576 2016 Charged MVB protein 5 is involved in T-cell receptor signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25637630 2015 A novel mechanism of regulating the ATPase VPS4 by its cofactor LIP5 and the endosomal sorting complex required for transport (ESCRT)-III protein CHMP5.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23619569 2013 The role of charged multivesicular body protein 5 in programmed cell death in leukemic cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
More...