Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NZY2 C9J8W9
Symbols HSPC053
KIAA0125
C14orf110

Gene

 Compartment GO Term (1)

AA Sequence

MGTLQGAALRSRERPSWPQETHGHRERTEEGCAVAAFSADALRTGGQELEQTGLRPKAGAPPMPDLLGHR      1 - 70
ICTDIGKGWRMDGGRTCSCSSFCRCPERGARRSSPDAPGLALDFPLLLDLLWHLCSWTSQPLEL           71 - 134
//

Text Mined References (8)

PMID Year Title