Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.86
PubTator Score 5.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis pigmentosa 24 15 4.769 2.4

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.400 4.1e-02
group 4 medulloblastoma -1.200 8.2e-04
invasive ductal carcinoma -1.200 6.0e-04
lung cancer 1.500 9.2e-04
non-small cell lung cancer 1.635 3.1e-16
ovarian cancer -1.700 6.0e-07

Synonym

Accession Q9NZW5 A4D157 Q9H0E1
Symbols VAM1
p55T
PALS2
VAM-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPL      1 - 70
INVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEP     71 - 140
LGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYR    141 - 210
DTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLE    211 - 280
EKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVG    281 - 350
RRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID    351 - 420
SILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTV    421 - 490
DESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY                        491 - 540
//

Text Mined References (18)

PMID Year Title