Property Summary

NCBI Gene PubMed Count 62
Grant Count 407
R01 Count 279
Funding $49,316,397.69
PubMed Score 679.58
PubTator Score 249.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.046 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.100 0.007
adult high grade glioma -1.400 0.001
ovarian cancer -1.600 0.000

Synonym

Accession Q9NZW4 A8MUI0 O95815
Symbols DPP
DSP
DGI1
DMP3
DFNA39

Gene

Gene RIF (47)

PMID Text
26829730 A novel pathogenic splicing-mutation c.52-1G>A of DSPP is associated with dentinogenesis imperfecta shields type II.
25805840 expression of MMP-20 and co-expression and potential interaction with DSPP in human major salivary gland tissues
25396425 Adhesive and migratory effects of phosphophoryn are modulated by flanking peptides of the integrin binding motif.
25158199 mutations of the DSP-PP P4 to P4' cleavage site can block, impair or accelerate dentin sialoprotein phosphophoryn cleavage, and suggest that its Bone morphogenic protein 1 cleavage site is conserved in order to regulate its cleavage efficiency
24441185 DMP1 and DSPP were more abundant in carious than in sound samples.
24400037 Domain of dentine sialoprotein mediates proliferation and differentiation of human periodontal ligament stem cells.
23589294 DSS domain of DPP functions as a novel cell-penetrating peptide, and these findings demonstrate new opportunities for intracellular delivery of therapeutic proteins and cell tracking in vivo.
23509818 analysis of a mutation in DSPP causing dentinogenesis imperfecta and characterization of the mutational effect
23297400 efficiency of dentin sialoprotein-phosphophoryn processing is affected by mutations both flanking and distant from the cleavage site
22521702 A review of hereditary dentine diseases resulting from mutations in DSPP gene suggests that the localization of mutation in the sequence of the DSPP gene might result in a different phenotype due to the diverse cellular fate of the mutated protein.
More...

AA Sequence

MKIITYFCIWAVAWAIPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQE      1 - 70
NTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQV     71 - 140
SIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNT    141 - 210
SEITPQINSKRNGTKEAEVTPGTGEDAGLDNSDGSPSGNGADEDEDEGSGDDEDEEAGNGKDSSNNSKGQ    211 - 280
EGQDHGKEDDHDSSIGQNSDSKEYYDPEGKEDPHNEVDGDKTSKSEENSAGIPEDNGSQRIEDTQKLNHR    281 - 350
ESKRVENRITKESETHAVGKSQDKGIEIKGPSSGNRNITKEVGKGNEGKEDKGQHGMILGKGNVKTQGEV    351 - 420
VNIEGPGQKSEPGNKVGHSNTGSDSNSDGYDSYDFDDKSMQGDDPNSSDESNGNDDANSESDNNSSSRGD    421 - 490
ASYNSDESKDNGNGSDSKGAEDDDSDSTSDTNNSDSNGNGNNGNDDNDKSDSGKGKSDSSDSDSSDSSNS    491 - 560
SDSSDSSDSDSSDSNSSSDSDSSDSDSSDSSDSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSKSDSSKSE    561 - 630
SDSSDSDSKSDSSDSNSSDSSDNSDSSDSSNSSNSSDSSDSSDSSDSSSSSDSSNSSDSSDSSDSSNSSE    631 - 700
SSDSSDSSDSDSSDSSDSSNSNSSDSDSSNSSDSSDSSNSSDSSDSSDSSNSSDSSDSSDSSNSSDSSDS    701 - 770
SDSSDSSDSSNSSDSNDSSNSSDSSDSSNSSDSSNSSDSSDSSDSSDSDSSNSSDSSNSSDSSDSSNSSD    771 - 840
SSDSSDSSDGSDSDSSNRSDSSNSSDSSDSSDSSNSSDSSDSSDSNESSNSSDSSDSSNSSDSDSSDSSN    841 - 910
SSDSSDSSNSSDSSESSNSSDNSNSSDSSNSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSNSSDSSDSS    911 - 980
NSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSSDSSNSSDSSNSSDSSNSSDSSDSSDSSDSSDSSDSSD    981 - 1050
SSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSESSDSSDSSNSSDSSDSSDSSDSSDSSDSSDSSDSSDS   1051 - 1120
SNSSDSSDSSDSSDSSDSSNSSDSSDSSESSDSSDSSDSSDSSDSSDSSDSSDSSDSSNSSDSSDSSDSS   1121 - 1190
DSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSSDSNESSDSSDSSDSSDSSNSSDSSDSSDSSD   1191 - 1260
STSDSNDESDSQSKSGNGNNNGSDSDSDSEGSDSNHSTSDD                                1261 - 1301
//

Text Mined References (66)

PMID Year Title
26829730 2016 [Identification of a novel mutation of DSPP gene in a Chinese family affected with dentinogenesis imperfecta shields type II].
25805840 2015 Expression of Matrix Metalloproteinase (MMP)-20 and Potential Interaction with Dentin Sialophosphoprotein (DSPP) in Human Major Salivary Glands.
25396425 2014 Adhesive and migratory effects of phosphophoryn are modulated by flanking peptides of the integrin binding motif.
25158199 2014 Site specificity of DSP-PP cleavage by BMP1.
24441185 2013 Dentin matrix protein 1 and dentin sialophosphoprotein in human sound and carious teeth: an immunohistochemical and colorimetric assay.
24400037 2013 Domain of dentine sialoprotein mediates proliferation and differentiation of human periodontal ligament stem cells.
23589294 2013 Acidic domain in dentin phosphophoryn facilitates cellular uptake: implications in targeted protein delivery.
23509818 2013 A DSPP mutation causing dentinogenesis imperfecta and characterization of the mutational effect.
23297400 2013 The efficiency of dentin sialoprotein-phosphophoryn processing is affected by mutations both flanking and distant from the cleavage site.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
More...