Property Summary

NCBI Gene PubMed Count 60
Grant Count 240
R01 Count 137
Funding $31,719,594.59
PubMed Score 236.89
PubTator Score 110.27

Knowledge Summary

Patent (4,501)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
ependymoma -2.400 0.001
medulloblastoma -2.800 0.002
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -4.500 0.000
lung cancer 3.800 0.000
fibroadenoma -1.300 0.015
non primary Sjogren syndrome sicca -1.100 0.028
subependymal giant cell astrocytoma -3.444 0.006
invasive ductal carcinoma -1.200 0.012
pituitary cancer -1.600 0.001
psoriasis -1.200 0.000

Synonym

Accession Q9NZV8 O95012 O95021 Q2TBD3 Q9UBY7 Q9UN98 Q9UNH9
Symbols RK5
KV4.2

Gene

Gene RIF (36)

PMID Text
26745419 closed-state inactivation in Kv4.2 channels is a multistep process
26209633 The stoichiometry of the Kv4.2-DPP10 complex was variable depending on the relative expression level of each subunit, with a preference for 4:2 stoichiometry
25756524 The study provides the first piece of evidence for the role of H2S in regulating Ito potassium channels and also the specific motif in an ion channel labile for H2S regulation.
25599232 The findings of this study suggest that variations in KCND2 genes are associated with both mild and severe persistent breast pain after breast cancer surgery.
25214526 A rare genetic mutation of the KCND2 gene, p.D612N, was identified in a single patient. Co-expression of mutant and wild-type KCND2 with KChIP2 demonstrated a gain-of-function phenotype.
25003238 reflected in the immunoblotting data KV4.2 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
24811166 Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4.
24675763 S-glutathionylation of an auxiliary subunit confers redox sensitivity to Kv4 channel inactivation.
24501278 study identified a de novo variant p.Val404Met in KCND2 in a family with identical twins affected with autism and severe seizures; findings suggest KCND2 is the causal gene for epilepsy in this family and has a role in the etiology of autism
24225951 WT PrP(C), in a DPP6-dependent manner, modulated Kv4.2 channel properties, causing an increase in peak amplitude
More...

AA Sequence

MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSS      1 - 70
ERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDR     71 - 140
RRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCG    141 - 210
SSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMT    211 - 280
DNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSS    281 - 350
ASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD    351 - 420
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTN    421 - 490
HEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQ    491 - 560
IRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL    561 - 630
//

Text Mined References (65)

PMID Year Title
26745419 2016 Intra- and Intersubunit Dynamic Binding in Kv4.2 Channel Closed-State Inactivation.
26209633 2015 Kv4.2 and accessory dipeptidyl peptidase-like protein 10 (DPP10) subunit preferentially form a 4:2 (Kv4.2:DPP10) channel complex.
25756524 2015 Hydrogen Sulfide Targets the Cys320/Cys529 Motif in Kv4.2 to Inhibit the Ito Potassium Channels in Cardiomyocytes and Regularizes Fatal Arrhythmia in Myocardial Infarction.
25599232 2015 Variations in potassium channel genes are associated with distinct trajectories of persistent breast pain after breast cancer surgery.
25214526 2014 Evaluation of genes encoding for the transient outward current (Ito) identifies the KCND2 gene as a cause of J-wave syndrome associated with sudden cardiac death.
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
24811166 2014 The stoichiometry and biophysical properties of the Kv4 potassium channel complex with K+ channel-interacting protein (KChIP) subunits are variable, depending on the relative expression level.
24675763 2014 S-glutathionylation of an auxiliary subunit confers redox sensitivity to Kv4 channel inactivation.
24501278 2014 Exome sequencing identifies de novo gain of function missense mutation in KCND2 in identical twins with autism and seizures that slows potassium channel inactivation.
24225951 2013 The prion protein modulates A-type K+ currents mediated by Kv4.2 complexes through dipeptidyl aminopeptidase-like protein 6.
More...