Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.42
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Salivary Gland Neoplasms 46 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
ovarian cancer 8520 1.1e-06
osteosarcoma 7950 3.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.234 3.0e-05
ovarian cancer 1.100 1.1e-06

Gene RIF (1)

AA Sequence

MYQPEDDNNSDVTSDDDMTRNRRESSPPHSVHSFSGDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDL      1 - 70
SLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQDNMENYRKLLSLGFLAQDSV     71 - 140
PAEKRNTEMLDNLPSAGSQFPDFKHLGTFLVFEELVTFEDVLVDFSPEELSSLSAAQRNLYREVMLENYR    141 - 210
NLVSLGHQFSKPDIISRLEEEESYAMETDSRHTVICQGESHDDPLEPHQGNQEKLLTPITMNDPKTLTPE    211 - 280
RSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRRHERIH    281 - 350
TGKKPYECKQCAEAFYLMPHLNRHQKTHSGRKTSGCNEGRKPSVQCANLCERVRIHSQEDYFECFQCGKA    351 - 420
FLQNVHLLQHLKAHEAARVLPPGLSHSKTYLIRYQRKHDYVGERACQCCDCGRVFSRNSYLIQHYRTHTQ    421 - 490
ERPYQCQLCGKCFGRPSYLTQHYQLHSQEKTVECDHC                                     491 - 527
//

Text Mined References (4)

PMID Year Title