Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
R01 Count 12
Funding $2,456,943.35
PubMed Score 34.47
PubTator Score 26.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 2.400 0.000
osteosarcoma -1.538 0.007
glioblastoma 1.100 0.003
tuberculosis 2.500 0.000
primary pancreatic ductal adenocarcinoma -1.824 0.004
intraductal papillary-mucinous adenoma (... -1.600 0.003
intraductal papillary-mucinous carcinoma... -1.300 0.024
ovarian cancer 1.200 0.001
pancreatic cancer -1.900 0.003

Gene RIF (9)

PMID Text
26875981 Selenoprotein R Protects Human Lens Epithelial Cells against D-Galactose-Induced Apoptosis by Regulating Oxidative Stress and Endoplasmic Reticulum Stress
24342607 MsrB1 protected human lens epithelial cells against the peroxynitrite-induced F-actin disruption
23988788 Silencing the expression of the main Msr elements-MsrA, MsrB1, or MsrB2 exacerbates sensitivity toward oxidative stress.
23270945 MsrB1 plays important roles in protecting HLE cell mitochondria against oxidative damage and inhibits oxidative stress-induced apoptosis in diabetic cataracts by scavenging ROS.
22713178 The results demonstrate that in human lens epithelial cells MsrB1 may play important roles in regulating redox balance and mitigating endoplasmic reticulum stress.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18081029 Strong candidate gene for schizophrenia; upregulated in lymphoblastoid cells of monozygotic twins.
17938273 The neutrophils expressed the highest activity Msrs. Msrs are important as antioxidant/repair systems for neutrophils, cells with enormous capacity for the generation of reactive oxidants and hence, susceptible to oxidative damage.
11779133 The studies in mouse show that MsrB is a selenoprotein that exhibits high specificity for reduction of the R forms of free and protein-bound methionine sulfoxide.

AA Sequence

MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVS      1 - 70
CGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH                             71 - 116
//

Text Mined References (19)

PMID Year Title
26875981 2016 Selenoprotein R Protects Human Lens Epithelial Cells against D-Galactose-Induced Apoptosis by Regulating Oxidative Stress and Endoplasmic Reticulum Stress.
24342607 2014 Effect of methionine sulfoxide reductase B1 (SelR) gene silencing on peroxynitrite-induced F-actin disruption in human lens epithelial cells.
23988788 2013 Proteome alteration in oxidative stress-sensitive methionine sulfoxide reductase-silenced HEK293 cells.
23270945 2013 Effect of methionine sulfoxide reductase B1 silencing on high-glucose-induced apoptosis of human lens epithelial cells.
22713178 2012 Involvement of MsrB1 in the regulation of redox balance and inhibition of peroxynitrite-induced apoptosis in human lens epithelial cells.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20634897 2010 Diversity of protein and mRNA forms of mammalian methionine sulfoxide reductase B1 due to intronization and protein processing.
18081029 2008 Up-regulation of ADM and SEPX1 in the lymphoblastoid cells of patients in monozygotic twins discordant for schizophrenia.
17938273 2008 Neutrophil granulocytes uniquely express, among human blood cells, high levels of Methionine-sulfoxide-reductase enzymes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...