Property Summary

NCBI Gene PubMed Count 21
Grant Count 21
R01 Count 16
Funding $2,909,753.16
PubMed Score 35.95
PubTator Score 37.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.600 0.002
posterior fossa group B ependymoma -3.800 0.000
oligodendroglioma -2.100 0.010
psoriasis -1.200 0.006
glioblastoma -4.200 0.000
medulloblastoma -4.500 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -4.300 0.000
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -2.900 0.000
subependymal giant cell astrocytoma -2.691 0.044
Pick disease -2.100 0.001
pituitary cancer 1.900 0.000
Down syndrome -1.200 0.001

Gene RIF (13)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.
22996592 Different kinetics of Ca-dependent binding step between caldendrin and calmodulin with AKAP79 suggest their different roles in synaptic function.
22693956 We demonstrate that calmodulin and caldendrin compete for a partially overlapping binding site on AKAP79 and that their binding is differentially dependent on calcium
21608059 Present the NMR structure of full-length CaBP1 with Ca(2+) bound at the first, third, and fourth EF-hands.
21383011 CaBP1 regulates voltage-dependent inactivation and activation of Ca(V)1.2 (L-type) calcium channels
21134641 Structural basis for the differential effects of CaBP1 and calmodulin on Ca(V)1.2 calcium-dependent inactivation.
19008222 CaBP1 may regulate Ca2+-dependent activity of inositol 1,4,5-trisphosphate receptors by promoting structural contacts between the suppressor and core domains
17960496 the importance of CaBP1s in modulating the stimulus-secretion coupling in excitable cells.
16147998 NMR, microcalorimetry, and other biophysical studies that characterize Ca(2+) binding, Mg(2+) binding, and structural properties of recombinant CaBP1 are reported.
15980432 the NT and IQ-domains of alpha(1)1.2 mediate functionally distinct interactions with CaBP1 and CaM that promote conformational alterations that either stabilize or inhibit inactivation of Ca(v)1.2.
More...

AA Sequence

MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSSHIAKSESKTS      1 - 70
LLKAAAAAASGGSRAPRHGPARDPGLPSRRLPGSCPATPQSSGDPSSRRPLCRPAPREEGARGSQRVLPQ     71 - 140
AHCRPREALPAAASRPSPSSPLPPARGRDGEERGLSPALGLRGSLRARGRGDSVPAAASEADPFLHRLRP    141 - 210
MLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGH    211 - 280
VDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRD    281 - 350
VDLNGDGRVDFEEFVRMMSR                                                      351 - 370
//

Text Mined References (28)

PMID Year Title
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
22996592 2012 Kinetic and mechanistic differences in the interactions between caldendrin and calmodulin with AKAP79 suggest different roles in synaptic function.
22693956 2012 AKAP79/150 interacts with the neuronal calcium-binding protein caldendrin.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21608059 2011 Nuclear magnetic resonance structure of calcium-binding protein 1 in a Ca(2+) -bound closed state: implications for target recognition.
21383011 2011 CaBP1 regulates voltage-dependent inactivation and activation of Ca(V)1.2 (L-type) calcium channels.
21134641 2010 Structural basis for the differential effects of CaBP1 and calmodulin on Ca(V)1.2 calcium-dependent inactivation.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
19008222 2009 Structural insights into Ca2+-dependent regulation of inositol 1,4,5-trisphosphate receptors by CaBP1.
17960496 2008 Ca2+ binding protein-1 inhibits Ca2+ currents and exocytosis in bovine chromaffin cells.
More...