Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.93
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG      1 - 70
RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE     71 - 140
KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE    141 - 210
EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE    211 - 280
PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT    281 - 350
KGQLLCPTCSKSKRS                                                           351 - 365
//

Text Mined References (16)

PMID Year Title