Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.41
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.2e-28
sonic hedgehog group medulloblastoma 467 7.8e-06
malignant mesothelioma 3232 3.4e-04
lung cancer 4740 4.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 4.1e-03
malignant mesothelioma 1.700 3.4e-04
psoriasis -1.200 9.2e-28
sonic hedgehog group medulloblastoma -1.600 7.8e-06

 MGI Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (1)

AA Sequence

MDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGI      1 - 70
PQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSI     71 - 140
EEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQR    141 - 210
IADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTT    211 - 280
LPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDEC    281 - 350
FETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTA    351 - 420
DSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVA    421 - 490
DETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRER    491 - 560
AYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTT    561 - 630
RGYRDGGIPDIDYSYT                                                          631 - 646
//

Text Mined References (11)

PMID Year Title