Property Summary

NCBI Gene PubMed Count 13
Grant Count 12
R01 Count 10
Funding $770,464.17
PubMed Score 19.36
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -6.500 0.000
astrocytic glioma -2.000 0.008
oligodendroglioma -1.500 0.018
glioblastoma -1.900 0.007
osteosarcoma 2.632 0.007
medulloblastoma, large-cell -2.600 0.000
non-small cell lung cancer -3.012 0.000
intraductal papillary-mucinous adenoma (... 1.800 0.030
lung cancer -4.000 0.000
interstitial cystitis -1.900 0.000
cystic fibrosis 1.400 0.001
lung adenocarcinoma -2.500 0.000
adult high grade glioma -1.500 0.003
posterior fossa group A ependymoma -1.200 0.004
Breast cancer -1.100 0.033
lung carcinoma -3.000 0.000
ulcerative colitis 1.500 0.008
ovarian cancer -3.900 0.000
pituitary cancer 2.600 0.000

Gene RIF (3)

PMID Text
26235030 Results suggest that UNC5 and LPHN3 can simultaneously bind to FLRT3, forming a trimeric complex, and that FLRT3 may form transsynaptic complexes with both LPHN3 and UNC5.
22405201 This study demonistrated that LPHN3 and its ligand FLRT3 play an important role in glutamatergic synapse development.
18593871 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQI      1 - 70
NNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSV     71 - 140
SAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNL    141 - 210
LNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSN    211 - 280
NNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNA    281 - 350
ELFDCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS    351 - 420
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMVPMETSNLYLF    421 - 490
DETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCWYVHRNGSLFS    491 - 560
RNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSES    561 - 630
SSNRSYRDSGIPDSDHSHS                                                       631 - 649
//

Text Mined References (16)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
22405201 2012 FLRT proteins are endogenous latrophilin ligands and regulate excitatory synapse development.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18593871 2008 Lack of C20orf133 and FLRT3 mutations in 43 patients with Kabuki syndrome in Japan.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706654 2004 FLRT3, a cell surface molecule containing LRR repeats and a FNIII domain, promotes neurite outgrowth.
More...