Property Summary

NCBI Gene PubMed Count 25
PubMed Score 75.44
PubTator Score 46.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.57382191373634E-5
osteosarcoma 7933 3.56374291173155E-5
psoriasis 6685 1.80560829633197E-4
Disease Target Count Z-score Confidence
Keratopathy 12 3.135 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 0.000
osteosarcoma 1.016 0.000
medulloblastoma, large-cell -1.100 0.000

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (13)

PMID Text
25853862 The blockade of OGF signaling by MNTX releases cells from their arrest and boosts the effect of Doc
23856908 The OGF-OGFr axis may be a feasible target for treatment of cancer of the ovary (i) in a prophylactic fashion, (ii) following cytoreduction or (iii) in conjunction with standard chemotherapy for additive effectiveness
22328595 OGF-OGFr axis is a determinant of the progression of human ovarian cancer
19923357 These data are the first to report that theOGFr system is a native biological regulator of cell proliferation in Hepatocellular carcinoma
19835629 OGF and OGFR are present in follicular-derived thyroid cancers, and that OGF serves in a inhibitory manner to maintain homeostasis of cell proliferation.
19675283 Opioid growth factor-opioid growth factor receptor axis is a physiological determinant of cell proliferation in diverse human cancers.
19297547 Cell proliferation of human ovarian cancer is regulated by the opioid growth factor-opioid growth factor receptor axis.
19244545 the regulation of cell proliferation by the OGF-OGFr axis is dependent on nucleocytoplasmic translocation and reliant on the integrity of two NLSs in OGFr to interact with transport receptors.
18923142 Results indicate that both p16(INK4a) and p21(WAF1/CIP1) are required for the opioid growth factor (OGF)-OGF receptor axis to inhibit cell proliferation in normal cells.
18636152 supports opioid growth factor receptor (OGFr) gene function as a regulator of cell proliferation that impacts on tumorigenic expression, and suggest that molecular and pharmacological manipulation of OGFr may prevent or delay human pancreatic cancer.
More...

AA Sequence

MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATR      1 - 70
DMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREP     71 - 140
GVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNN    141 - 210
LRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRP    211 - 280
RCKFVWGPQDKLRRFKPSSLPHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSV    281 - 350
EPQDAGPLERSQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS    351 - 420
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGH    421 - 490
PKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSE    491 - 560
TPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPA    561 - 630
GDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSGKP                           631 - 677
//

Text Mined References (37)

PMID Year Title
26687326 2016 Antagonism of the Met5-enkephalin-opioid growth factor receptor-signaling axis promotes MSC to differentiate into osteoblasts.
25853862 2015 Peripheral opioid antagonist enhances the effect of anti-tumor drug by blocking a cell growth-suppressive pathway in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23856908 2013 Targeting the opioid growth factor: opioid growth factor receptor axis for treatment of human ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22328595 2012 Under-expression of the opioid growth factor receptor promotes progression of human ovarian cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...