Property Summary

NCBI Gene PubMed Count 26
PubMed Score 79.36
PubTator Score 46.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.6e-05
osteosarcoma 7950 3.6e-05
psoriasis 6694 5.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Keratopathy 12 3.075 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 2.6e-05
osteosarcoma 1.016 3.6e-05
psoriasis 1.200 5.7e-04

Gene RIF (14)

AA Sequence

MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATR      1 - 70
DMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREP     71 - 140
GVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNN    141 - 210
LRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRP    211 - 280
RCKFVWGPQDKLRRFKPSSLPHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSV    281 - 350
EPQDAGPLERSQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS    351 - 420
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGH    421 - 490
PKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSE    491 - 560
TPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPA    561 - 630
GDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSGKP                           631 - 677
//

Text Mined References (38)

PMID Year Title