Property Summary

NCBI Gene PubMed Count 25
Grant Count 11
R01 Count 5
Funding $936,950.2
PubMed Score 75.44
PubTator Score 46.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.300 0.000
osteosarcoma 1.016 0.000
medulloblastoma, large-cell -1.100 0.000

Gene RIF (13)

PMID Text
25853862 The blockade of OGF signaling by MNTX releases cells from their arrest and boosts the effect of Doc
23856908 The OGF-OGFr axis may be a feasible target for treatment of cancer of the ovary (i) in a prophylactic fashion, (ii) following cytoreduction or (iii) in conjunction with standard chemotherapy for additive effectiveness
22328595 OGF-OGFr axis is a determinant of the progression of human ovarian cancer
19923357 These data are the first to report that theOGFr system is a native biological regulator of cell proliferation in Hepatocellular carcinoma
19835629 OGF and OGFR are present in follicular-derived thyroid cancers, and that OGF serves in a inhibitory manner to maintain homeostasis of cell proliferation.
19675283 Opioid growth factor-opioid growth factor receptor axis is a physiological determinant of cell proliferation in diverse human cancers.
19297547 Cell proliferation of human ovarian cancer is regulated by the opioid growth factor-opioid growth factor receptor axis.
19244545 the regulation of cell proliferation by the OGF-OGFr axis is dependent on nucleocytoplasmic translocation and reliant on the integrity of two NLSs in OGFr to interact with transport receptors.
18923142 Results indicate that both p16(INK4a) and p21(WAF1/CIP1) are required for the opioid growth factor (OGF)-OGF receptor axis to inhibit cell proliferation in normal cells.
18636152 supports opioid growth factor receptor (OGFr) gene function as a regulator of cell proliferation that impacts on tumorigenic expression, and suggest that molecular and pharmacological manipulation of OGFr may prevent or delay human pancreatic cancer.
More...

AA Sequence

MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATR      1 - 70
DMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREP     71 - 140
GVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNN    141 - 210
LRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRP    211 - 280
RCKFVWGPQDKLRRFKPSSLPHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSV    281 - 350
EPQDAGPLERSQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS    351 - 420
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGH    421 - 490
PKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSE    491 - 560
TPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPA    561 - 630
GDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSGKP                           631 - 677
//

Text Mined References (37)

PMID Year Title
26687326 2016 Antagonism of the Met5-enkephalin-opioid growth factor receptor-signaling axis promotes MSC to differentiate into osteoblasts.
25853862 2015 Peripheral opioid antagonist enhances the effect of anti-tumor drug by blocking a cell growth-suppressive pathway in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23856908 2013 Targeting the opioid growth factor: opioid growth factor receptor axis for treatment of human ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22328595 2012 Under-expression of the opioid growth factor receptor promotes progression of human ovarian cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...