Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.95
PubTator Score 42.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4607 3.7e-03
glioblastoma 5635 6.1e-03
esophageal adenocarcinoma 696 1.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma 1.400 1.8e-02
glioblastoma 1.300 6.1e-03
lung cancer -1.100 3.7e-03

Gene RIF (4)

AA Sequence

MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTEC      1 - 70
PECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQM     71 - 140
GGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERV    141 - 210
NGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPR    211 - 280
LSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWD    281 - 350
WLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN    351 - 420
CLFYWALYFNPIINIDLVVKELRRLETQVL                                            421 - 450
//

Text Mined References (11)

PMID Year Title