Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $135,491.38
PubMed Score 3.61
PubTator Score 42.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma 1.400 0.018
glioblastoma 1.300 0.006
lung cancer -1.100 0.004

Synonym

Accession Q9NZS9 A8K4Z9 B4DUT0 D3DUG8
Symbols BAR
RNF47

Gene

 Grant Application (2)

Gene RIF (4)

PMID Text
22566094 Data show that p75NTR and BFAR co-localized within the cytoplasm.
21068390 post-translational regulation of the BI-1 protein by E3 ligase BAR contributes to the dynamic control of IRE1 signaling during endoplasmic reticulum stress
20523265 Observational study of gene-disease association. (HuGE Navigator)
18805781 Over-expression of BFAR Delta RING renders the heart more resistant to I/R injury and DOX-induced cardiotoxicity, and this protection correlates with reduced cardiomyocyte apoptosis.

AA Sequence

MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTEC      1 - 70
PECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQM     71 - 140
GGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERV    141 - 210
NGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPR    211 - 280
LSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWD    281 - 350
WLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN    351 - 420
CLFYWALYFNPIINIDLVVKELRRLETQVL                                            421 - 450
//

Text Mined References (11)

PMID Year Title
22566094 2012 p75NTR signal transduction suppressed by BFAR and p75NTR interactions.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21068390 2011 Bifunctional apoptosis regulator (BAR), an endoplasmic reticulum (ER)-associated E3 ubiquitin ligase, modulates BI-1 protein stability and function in ER Stress.
20523265 2010 Association study of complement factor H, C2, CFB, and C3 and age-related macular degeneration in a Han Chinese population.
18805781 2009 Over-expression of a modified bifunctional apoptosis regulator protects against cardiac injury and doxorubicin-induced cardiotoxicity in transgenic mice.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14502241 2003 Bifunctional apoptosis inhibitor (BAR) protects neurons from diverse cell death pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...