Property Summary

NCBI Gene PubMed Count 406
Grant Count 659
R01 Count 328
Funding $65,977,733.83
PubMed Score 2228.28
PubTator Score 912.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NZQ7 B2RBA2 B4DU27 Q14CJ2 Q2V8D5 Q66RK1 Q6WEX4 Q9NUZ5 PD-L1
Symbols B7-H
B7H1
PDL1
PD-L1
PDCD1L1
PDCD1LG1

Gene

PDB

3BIK   3BIS   3FN3   3SBW   4Z18   4ZQK   5C3T   5J89   5J8O  

Gene RIF (397)

PMID Text
27065104 Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression
26927720 Data suggest signaling via CD279/PDCD1 and its ligand CD274/PD-L1 is effective chemotherapy target in non-small cell lung cancer; PD-L1 is best currently available immunohistochemistry biomarker for response to immune checkpoint inhibitors. [REVIEW]
26927379 Data show that interferon-gamma could up-regulate the number of IL-10(+)T cells differentiated in the present of placenta mesenchymal stem cells (hPMSCs) by enhancing the expression of programmed death ligand 1 (PD-L1) in hPMSCs.
26913631 We observed cogain or coamplification of CD274 and PDCD1LG2 in 32 of 48 cervical and 10 of 23 vulvar squamous cell carcinomas
26867643 PD-L1 expression in neutrophils is elevated in patients with systemic lupus erythematosus.
26771872 Proposed that PD-L1 expression in combination with CD8+ tumor infiltrating lymphocyte density could be a useful predictive biomarker in patients with stage III NSCLC.
26762740 Genetic amplification of the PD-L1 gene was correlated with Non-Small Cell Lung Cancer.
26754191 PD-L1 is a novel target of HIF-2alpha and provide evidence of a link between VHL mutations, the HIF-2alpha signalling pathway and PD-L1 expression, indicating that the VHL-HIF-2alpha axis has a crucial role in the PD-L1 response in this disease
26752545 PD-L1 and PD-L2 are useful new markers for identifying select histiocyte and dendritic cell disorders and reveal novel patient populations as rational candidates for immunotherapy
26676749 overexpressed EGFR significantly correlated with JAK2 and PD-L1 expression in a large cohort of head and neck cancer specimens.
More...

AA Sequence

MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHG      1 - 70
EEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQR     71 - 140
ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCT    141 - 210
FRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSK    211 - 280
KQSDTHLEET                                                                281 - 290
//

Text Mined References (408)

PMID Year Title
27065104 2016 A Potential Inhibitory Profile of Liver CD68+ Cells during HCV Infection as Observed by an Increased CD80 and PD-L1 but Not CD86 Expression.
26927720 2016 Non-Small Cell Lung Cancer, PD-L1, and the Pathologist.
26927379 2016 [IFN-? up-regulates PD-L1 expression in human placenta mesenchymal stem cells and enhances cell ability to induce the differentiation of IL-10+ T cells from cord blood- and peripheral blood-derived T cells].
26913631 2016 Genetic Basis for PD-L1 Expression in Squamous Cell Carcinomas of the Cervix and Vulva.
26867643 2016 PD-L1-expressing neutrophils as a novel indicator to assess disease activity and severity of systemic lupus erythematosus.
26771872 2016 Predictive relevance of PD-L1 expression combined with CD8+ TIL density in stage III non-small cell lung cancer patients receiving concurrent chemoradiotherapy.
26762740 2016 PD-L1 Is Upregulated by Simultaneous Amplification of the PD-L1 and JAK2 Genes in Non-Small Cell Lung Cancer.
26754191 2016 Kidney cancer: Programmed death ligand 1 regulation in ccRCC.
26752545 2016 Expression of Programmed Cell Death 1 Ligands (PD-L1 and PD-L2) in Histiocytic and Dendritic Cell Disorders.
26676749 2016 Identification of the Cell-Intrinsic and -Extrinsic Pathways Downstream of EGFR and IFN? That Induce PD-L1 Expression in Head and Neck Cancer.
More...