Property Summary

NCBI Gene PubMed Count 24
Grant Count 1
R01 Count 1
Funding $95,321.33
PubMed Score 14.92
PubTator Score 223.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma -1.300 0.000
group 4 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.600 0.000
lung cancer 1.200 0.001
subependymal giant cell astrocytoma -1.686 0.007

Synonym

Accession Q9NZQ3 B4DFL5 Q6GU34 Q6SPF3 Q8TC10 Q9UGM8
Symbols DIP
DIP1
ORF1
WISH
VIP54
AF3P21
SPIN90
WASLBP

Gene

 Grant Application (1)

Gene RIF (11)

PMID Text
24340049 findings suggest that SPIN90 contributes to the formation and movement of endosomal vesicles, and modulates the stability of EGFR protein, which affects cell cycle progression
23765104 SPIN90 dephosphorylation is a prerequisite step for releasing cofilin so that cofilin can adequately sever actin filaments into monomeric form.
23342115 Findings show that SPIN90 modulates synaptic activity in neurons as a result of its phosphorylation.
23024796 Dia2 and DIP co-tether to nascent blebs and this linkage is required for bleb formation.
22082156 Knockdown of NCK interacting protein with SH3 domain (NCKIPSD) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19460367 SPIN90 and IRSp53 positively cooperated to mediate Rac activation, and co-expression of SPIN90 and IRSp53 in COS-7 cells led to the complex formation of SPIN90-IRSp53 in the leading edge of cells
17537434 The interplay between palladin, SPIN90 and Src and characterized the role of palladin and SPIN90 in platelet derived growth factor and Src-induced cytoskeletal remodeling, was analyzed.
17398099 DIP binds to and inhibits actin assembly by the FH2 domain of the formin mDia2
17398099 These observations point to a pivotal role for DIP in the control of nonbranched and branched actin-filament assembly that is mediated by Diaphanous-related formins and activators of Arp2/3, respectively.
16253999 SPIN90 participates in reorganization of the actin cytoskeleton and in actin-based cell motility
More...

AA Sequence

MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRA      1 - 70
IEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRA     71 - 140
GFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGN    141 - 210
SVSSGSSVSSTSLDTLYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGT    211 - 280
TSASDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASS    281 - 350
PVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHI    351 - 420
LTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARD    421 - 490
MQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLA    491 - 560
LNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAI    561 - 630
FYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQC    631 - 700
QMDRMIVREMCKEFLVLGEAPS                                                    701 - 722
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24340049 2013 SPIN90 knockdown attenuates the formation and movement of endosomal vesicles in the early stages of epidermal growth factor receptor endocytosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23765104 2013 SPIN90 dephosphorylation is required for cofilin-mediated actin depolymerization in NMDA-stimulated hippocampal neurons.
23342115 2013 SPIN90 phosphorylation modulates spine structure and synaptic function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024796 2012 Dia-interacting protein (DIP) imposes migratory plasticity in mDia2-dependent tumor cells in three-dimensional matrices.
22419821 2012 Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.
21269460 2011 Initial characterization of the human central proteome.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
More...