Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.98
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.600 0.029
glioblastoma -1.700 0.000
osteosarcoma -3.437 0.000
posterior fossa group B ependymoma -1.300 0.000
sonic hedgehog group medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -2.100 0.000
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.300 0.000
invasive ductal carcinoma -1.690 0.000
Pick disease -1.200 0.008
ovarian cancer -1.600 0.000
chronic rhinosinusitis -1.086 0.002

Gene RIF (2)

PMID Text
24746703 these data suggest that RBJ may be an oncogenic Ras-related small GTPase mediating nuclear accumulation of active MEK1/MEK2 in tumor progression.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF      1 - 70
DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK     71 - 140
HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR    141 - 210
RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK           211 - 273
//

Text Mined References (15)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24746703 2014 Small GTPase RBJ mediates nuclear entrapment of MEK1/MEK2 in tumor progression.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...