Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.98
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.600 2.9e-02
glioblastoma -1.700 2.8e-05
osteosarcoma -3.437 3.5e-10
posterior fossa group B ependymoma -1.300 1.1e-04
sonic hedgehog group medulloblastoma -1.400 4.6e-04
atypical teratoid / rhabdoid tumor -2.000 1.0e-07
medulloblastoma, large-cell -2.100 3.5e-05
adult high grade glioma -2.000 3.9e-05
pilocytic astrocytoma -1.300 1.2e-06
invasive ductal carcinoma -1.690 1.4e-04
Pick disease -1.200 7.6e-03
ovarian cancer -1.600 4.0e-09
chronic rhinosinusitis -1.086 2.3e-03

Gene RIF (2)

PMID Text
24746703 these data suggest that RBJ may be an oncogenic Ras-related small GTPase mediating nuclear accumulation of active MEK1/MEK2 in tumor progression.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF      1 - 70
DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK     71 - 140
HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR    141 - 210
RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK           211 - 273
//

Text Mined References (15)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24746703 2014 Small GTPase RBJ mediates nuclear entrapment of MEK1/MEK2 in tumor progression.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14980719 2004 RJLs: a new family of Ras-related GTP-binding proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.