Property Summary

NCBI Gene PubMed Count 3
PubMed Score 27.99
PubTator Score 19.82

Knowledge Summary

Patent (436)

AA Sequence

PLLNPFIYTLRNKQVKQAFSDSIKRIAFLSKK                                          281 - 312

Text Mined References (3)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.