Property Summary

NCBI Gene PubMed Count 3
Grant Count 4
R01 Count 4
Funding $469,206.68
PubMed Score 27.99
PubTator Score 19.82

Knowledge Summary

Patent (436)

AA Sequence

MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFFLRNFSFLEVS      1 - 70
FTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDRYVAICKPLHYVVIMNNRVCT     71 - 140
LLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAGPLLKISCSDTWVIEQMVILMAVFALIITLV    141 - 210
CVILSYLYIVRTILKFPSVQQRKKAFSTCSSHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVA    211 - 280
PLLNPFIYTLRNKQVKQAFSDSIKRIAFLSKK                                          281 - 312
//

Text Mined References (3)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.