Property Summary

NCBI Gene PubMed Count 3
PubMed Score 29.68
PubTator Score 19.82

Knowledge Summary

Patent (436)

AA Sequence

MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFFLRNFSFLEVS      1 - 70
FTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDRYVAICKPLHYVVIMNNRVCT     71 - 140
LLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAGPLLKISCSDTWVIEQMVILMAVFALIITLV    141 - 210
CVILSYLYIVRTILKFPSVQQRKKAFSTCSSHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVA    211 - 280
PLLNPFIYTLRNKQVKQAFSDSIKRIAFLSKK                                          281 - 312
//

Text Mined References (3)

PMID Year Title