Property Summary

NCBI Gene PubMed Count 3
PubMed Score 14.76
PubTator Score 7.48

Knowledge Summary

Patent (192)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Mastitis 48 3.67 1.8
Narcolepsy 58 1.0

AA Sequence

MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFLRNFSFLEISF      1 - 70
TTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRYVAICKPLHYTSIMNRKLCTL     71 - 140
LVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYFALVTLLFTLAL    141 - 210
VILSYMYIIRTILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAP    211 - 280
MLNPFIYTLRNQQVKQAFKNVVHKVVFYANQ                                           281 - 311
//

Text Mined References (3)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.