Property Summary

NCBI Gene PubMed Count 3
PubMed Score 14.83
PubTator Score 7.48

Knowledge Summary

Patent (192)

AA Sequence

MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFLRNFSFLEISF      1 - 70
TTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRYVAICKPLHYTSIMNRKLCTL     71 - 140
LVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYFALVTLLFTLAL    141 - 210
VILSYMYIIRTILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAP    211 - 280
MLNPFIYTLRNQQVKQAFKNVVHKVVFYANQ                                           281 - 311
//

Text Mined References (3)

PMID Year Title