Property Summary

NCBI Gene PubMed Count 69
PubMed Score 59.00
PubTator Score 79.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leber Congenital Amaurosis 4 3 0.0 0.0
Retinitis Pigmentosa 226 0.0 0.0
Disease Target Count P-value
adult high grade glioma 3801 6.6e-04
group 3 medulloblastoma 4104 3.9e-02
Disease Target Count Z-score Confidence
cone-rod dystrophy 59 0.0 5.0
Disease Target Count
Leber congenital amaurosis 69

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 6.6e-04
group 3 medulloblastoma 2.000 3.9e-02

Gene RIF (25)

AA Sequence

MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLE      1 - 70
VWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDEL     71 - 140
QKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLGRYEEASSKYQEAIICLRN    141 - 210
LQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNE    211 - 280
AEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEP    281 - 350
PAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH                                        351 - 384
//

Text Mined References (69)

PMID Year Title